KEGG   Mus musculus (mouse): 15170
Entry
15170             CDS       T01002                                 

Gene name
Ptpn6, 70Z-SHP, Hcph, PTPTY-42, Ptp, Ptp1C, SH-PTP1, SHP, SHP-1, hc, hcp, me
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 6
  KO
K05697  tyrosine-protein phosphatase non-receptor type 6 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04520  Adherens junction
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu05140  Leishmaniasis
mmu05205  Proteoglycans in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15170 (Ptpn6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    15170 (Ptpn6)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15170 (Ptpn6)
   04660 T cell receptor signaling pathway
    15170 (Ptpn6)
   04662 B cell receptor signaling pathway
    15170 (Ptpn6)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    15170 (Ptpn6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    15170 (Ptpn6)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    15170 (Ptpn6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    15170 (Ptpn6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     15170 (Ptpn6)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    15170 (Ptpn6)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase HGAL
Other DBs
NCBI-GeneID: 15170
NCBI-ProteinID: NP_038573
MGI: 96055
Ensembl: ENSMUSG00000004266
Vega: OTTMUSG00000038210
UniProt: P29351 Q3UB72
Position
6 F2; 6 59.17 cM
AA seq 595 aa
MVRWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHISGGQA
ESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
SETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGRNK
CVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQKGQESEYGNIT
YPPAVRSAHAKASRTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggtgaggtggtttcaccgggacctcagcgggcctgatgcagagaccctgctgaagggc
cggggagtccctgggagcttcctggctcggcccagccgcaagaaccagggtgacttctcc
ctctcagtcagggtggatgatcaggtgactcatattcggatccagaactcaggggacttc
tatgacctgtacggaggggagaagtttgcgacgctgacagagctggtcgagtattacacg
cagcagcagggcatcctgcaggaccgagatggcaccatcatccaccttaagtacccactg
aactgctcggaccccaccagtgagaggtggtaccacggccacatatctggagggcaggcg
gagtcactgctgcaggccaagggcgagccctggacatttcttgtgcgtgagagtctcagc
caacctggtgattttgtgctctctgtgctcaatgaccagcccaaggctggcccaggttcc
ccgctcagggtcactcatatcaaggttatgtgtgagggtggacgctatactgtgggtggc
tcagagacgtttgacagcctcacagacctggtggagcacttcaagaagacagggattgag
gaggcctcgggtgcctttgtctacctgcggcagccttactacgctactcgggtaaacgca
gctgacattgagaatcgggtcttggaactgaacaagaagcaggagtcggaggacacagcc
aaggctggcttctgggaggagtttgagagtctacaaaagcaggaggtaaagaatctacac
caacgtctggaagggcagcggccagagaacaagagcaagaaccgctacaagaacattctt
ccctttgaccacagccgagtgatcctgcagggacgtgacagtaacatcccaggctctgac
tacatcaatgccaactacgtgaagaaccagctgctaggtccagatgagaactctaagacc
tacatcgccagccagggctgtctggatgccacagtcaatgacttctggcagatggcttgg
caggagaacactcgtgtcatcgtcatgactaccagagaggtggagaaaggccggaacaaa
tgtgtcccatactggcccgaggtgggcactcagcgtgtctatggtctctactctgtgacc
aacagtagggagcatgacacagcagaatacaaactgcgaacattacagatctccccacta
gacaatggggacctggttcgggagatatggcactaccagtacctgagctggcctgaccat
ggggttcccagtgagcctgggggtgtcctcagctttctggatcagatcaaccagcgacag
gaaagtttgcctcatgcagggcccatcattgtgcattgcagcgctggcatcggccgcacg
ggcaccatcatcgtcattgatatgcttatggaaagcatctccaccaaggggctagactgt
gacattgatatccagaagaccatccagatggtacgagcacagcgctccggcatggtgcag
accgaggcccagtacaagtttatttacgtggccattgcccagttcatcgaaacgaccaag
aagaaactggagatcatacaatcccagaagggccaggagtcggagtatgggaatatcacg
taccctcccgctgtgaggagtgcccacgccaaagcctcgcgtacttcctccaagcacaag
gaggaggtgtacgaaaacgtgcatagcaagagcaagaaggaagagaaagtaaagaagcag
cggtcggcagacaaggagaagaacaaaggttctctcaagaggaagtga

DBGET integrated database retrieval system