KEGG   Mus musculus (mouse): 15191Help
Entry
15191             CDS       T01002                                 

Gene name
Hdgf, AI118077, D3Ertd299e
Definition
(RefSeq) heparin binding growth factor
  KO
K16641  hepatoma-derived growth factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15191 (Hdgf)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   15191 (Hdgf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP
Motif
Other DBs
NCBI-GeneID: 15191
NCBI-ProteinID: NP_032257
MGI: 1194494
Ensembl: ENSMUSG00000004897
Vega: OTTMUSG00000027208
UniProt: P51859
Position
3 F1; 3 38.78 cM
AA seq 237 aa AA seqDB search
MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGP
KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCAAEPEVEPEAHE
GDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDK
EIAALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHESL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgatccaaccggcagaaagagtacaagtgcggagacctggtgtttgcgaagatg
aaaggatacccacactggccggcccggattgatgagatgcctgaggctgcagtgaagtca
acagccaacaaataccaagtctttttttttgggacccatgagacggcattcctgggcccc
aaagacctcttcccttatgaggaatccaaggagaagtttggcaagcccaacaagaggaaa
gggttcagcgaggggctgtgggagatcgagaacaaccctacagtcaaggcctctggctac
cagtcctcccagaaaaagagttgtgcggcagagcccgaggtggagcccgaagcccatgag
ggtgacggtgataagaagggcagtgcagagggcagcagcgacgaagaagggaaactggtg
atcgatgaaccagccaaggagaagaacgaaaagggcacgctgaagaggagagcaggggat
gtgttggaggactcccctaaacgtcccaaggagtcaggagaccatgaggaggaggacaag
gagatagctgccttggagggtgagaggcccctgcctgtagaggtggagaagaacagcacc
ccctctgagccagactctggccagggacctcctgcagaggaagaagagggagaggaagag
gctgccaaggaagaggctgaagcccagggcgtcagagatcatgagagcctgtag

DBGET integrated database retrieval system