KEGG   Mus musculus (mouse): 15200
Entry
15200             CDS       T01002                                 

Gene name
Hbegf, AW047313, Dt, Dtr, Dts, Hegf, Hegfl
Definition
(RefSeq) heparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04012  ErbB signaling pathway
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05171  Coronavirus disease - COVID-19
mmu05205  Proteoglycans in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    15200 (Hbegf)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    15200 (Hbegf)
   04915 Estrogen signaling pathway
    15200 (Hbegf)
   04928 Parathyroid hormone synthesis, secretion and action
    15200 (Hbegf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    15200 (Hbegf)
  09162 Cancer: specific types
   05219 Bladder cancer
    15200 (Hbegf)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    15200 (Hbegf)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    15200 (Hbegf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15200 (Hbegf)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   15200 (Hbegf)
SSDB
Motif
Pfam: EGF Syndecan
Other DBs
NCBI-GeneID: 15200
NCBI-ProteinID: NP_034545
MGI: 96070
Ensembl: ENSMUSG00000024486
UniProt: Q06186 Q5FW64
Position
18 B2; 18 19.46 cM
AA seq 208 aa
MKLLPSVMLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGSTNQLLPTGGDRAQG
VQDLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGE
CRYLQEFRTPSCKCLPGYHGHRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDLESEEKVKLGVASSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtgatgctgaagctctttctggccgcagtgttgtccgcgttg
gtgaccggtgagagtctggagcggcttcggagaggtctggcggcagcaaccagcaaccct
gaccctcccactggatccacaaaccagctgctacccacgggaggtgatcgtgctcagggg
gtccaggacttggaagggacagatctgaaccttttcaaagttgctttctcctccaagcca
caaggcctggccaccccaagcaaagaaaggaatgggaaaaagaagaagaaaggaaagggg
ttagggaagaagagagacccatgcctcaggaaatacaaggactactgcatccacggggag
tgcagatacctgcaggagttccgtactccctcttgcaaatgcctccctggttaccacgga
cacaggtgtcatgggctgactctaccagtggagaatcccctatacacatatgaccacact
acagtcttggctgtggtggctgtagtactgtcgtccgtctgtcttcttgtcatcgtggga
cttctcatgtttaggtaccacaggagaggaggttatgacttggaaagtgaagagaaagtg
aagttgggcgtggctagctcccactga

DBGET integrated database retrieval system