KEGG   Mus musculus (house mouse): 15201
Entry
15201             CDS       T01002                                 
Symbol
Hells, E130115I21Rik, LSH, Lysh, PASG, YFK8
Name
(RefSeq) helicase, lymphoid specific
  KO
K19001  ATP-dependent DNA helicase
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15201 (Hells)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    15201 (Hells)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII AAA_19 Shugoshin_C
Other DBs
NCBI-GeneID: 15201
NCBI-ProteinID: NP_032260
MGI: 106209
Ensembl: ENSMUSG00000025001
UniProt: Q60848
Position
19:38913282..38958914
AA seq 821 aa
MAEQTEPAVITPAMLEEEEQLEAAGLEKERKMLEEAQKSWDRESTEIRYRRLQHLLEKSN
IYSKFLLTKMEQQQLEEQKKKEKLEKKKRSLKLTEGKSLVDGNGEKPVMKKKRGREDESY
NISEVMSKEEILSVAKKHKDNEDESSSTTSLCVEDIQKNKDSNSMIKDRLSQTVRQNSKF
FFDPVRKCNGQPVPFQQPKHFTGGVMRWYQVEGMEWLRMLWENGINGILADEMGLGKTVQ
CIATIALMIQRGVPGPFLVCGPLSTLPNWMAEFKRFTPEIPTLLYHGTREDRRKLVKNIH
KRQGTLQIHPVVVTSFEIAMRDQNALQHCYWKYLIVDEGHRIKNMKCRLIRELKRFNADN
KLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQNVL
HMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLCNKQEIFYTAIVNRTIANMFGSCEK
ETVELSPTGRPKRRSRKSINYSELDQFPSELEKLISQIQPEVNRERTVVEGNIPIESEVN
LKLRNIMMLLRKCCNHPYMIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPELKKRGHK
VLVFSQMTSMLDILMDYCHLRNFIFSRLDGSMSYSEREKNIYSFNTDPDVFLFLVSTRAG
GLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVERAA
AKRKLEKLIIHKNHFKGGQSGLSQSKNFLDAKELMELLKSRDYEREVKGSREKVISDEDL
ELLLDRSDLIDQMKASRPIKGKTGIFKILENSEDSSAECLF
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggccgaacaaacggagcctgcggtgattactccagccatgctggaggaggaggaacag
ctcgaggctgcgggacttgagaaagagcggaagatgttagaagaggctcaaaagtcttgg
gacagagagtccactgaaattcggtaccgcagacttcagcatttgcttgaaaaaagcaat
atctactcaaaatttttgttgactaaaatggaacaacagcaattggaggaacagaagaag
aaagagaagttggagaaaaaaaaacggtcattaaaacttacagagggtaaaagtttagtt
gatgggaatggagagaaaccagtcatgaaaaagaaaagaggaagagaagatgaatcttat
aatatttcagaggtcatgtcaaaagaggaaattttgtccgtagctaaaaaacataaggat
aatgaggatgaaagctcttccactacgagtctttgtgtagaagatattcagaaaaataag
gattcaaatagtatgattaaagatagattgtctcaaactgttaggcagaattctaaattc
ttttttgacccagttcggaaatgtaacggacagcctgtaccctttcaacaaccaaagcat
ttcacaggaggagtaatgaggtggtaccaagtagaaggcatggaatggcttaggatgctt
tgggaaaatggaattaatggcattttagcagatgaaatgggtttgggaaagactgttcag
tgcattgctacaattgcattgatgattcagaggggagtacctggaccttttcttgtttgt
ggccctttgtctacacttcctaactggatggctgaatttaaaagatttactccagaaatt
cctactctgctgtatcatggaacccgggaggaccgtcggaaattagtaaagaatatccac
aaaagacaagggacactgcagattcatcctgtggtggtcacatcattcgagatcgctatg
cgagaccagaatgctttacagcattgctattggaaatacttaatagtagatgaaggacac
aggattaagaatatgaagtgccggctaatcagggagttaaaacggttcaatgctgataac
aaacttcttttgactggtactcccttgcaaaacaatttatcagaactttggtcattgcta
aactttttgttgccagatgtatttgatgacttgaaaagctttgagtcttggtttgatatc
actagtctttctgaaactgctgaagatattatagctaaagagagagaacagaatgtttta
catatgctgcaccagattttaacgcctttcctactgagaagactgaagtctgatgttgct
cttgaagtcccccctaagcgagaagtagttgtttatgcaccactttgcaataaacaagag
atcttctatacagctattgtgaaccgcacaattgcaaacatgtttggatcctgtgagaag
gaaacagttgagctaagtcctactggaagaccaaaacgacgaagtagaaagtcaataaat
tacagcgaactagatcagttccctagtgaattagaaaaactaataagtcaaatacagcca
gaagtaaacagagagaggactgttgtggaaggtaatatccctatagaatctgaagttaat
ctgaagctgcggaatataatgatgctacttcgaaagtgctgtaatcacccatatatgatt
gaatatcctattgaccctgtcacacaagaatttaagattgatgaagagttggtaacaaat
tctgggaagttcttaattttggatcgaatgctgcccgaacttaaaaaaagaggtcacaag
gttctggtgttttcacaaatgacaagcatgttggacatcttgatggattattgccatctt
agaaacttcatctttagcagacttgatgggtccatgtcttattcggaaagagaaaaaaat
atatacagtttcaacacggatccagatgtttttcttttcttagtgagtacacgagctggt
ggtttaggcataaacttgactgcagcagatacagtgatcatttatgacagtgattggaat
cctcagtctgatctccaggctcaagatagatgtcatagaattggtcagacaaagccagtt
gttgtgtatcgtcttgtaacagcaaatactattgaccagaaaattgtggaaagagcagct
gctaaaagaaagttggagaagttgataatccataaaaatcatttcaaaggtggtcagtct
gggttaagtcaatctaagaatttcttagatgcaaaggaattaatggagttattaaaatct
agagattatgaaagggaagtaaaaggatccagagagaaggtcattagtgacgaagatcta
gaattactgttggatcgaagtgatctcattgatcaaatgaaggcttcaagaccaattaaa
gggaagacagggatattcaaaatactagaaaattctgaagattccagtgctgaatgttta
ttttaa

DBGET integrated database retrieval system