KEGG   Mus musculus (mouse): 15204
Entry
15204             CDS       T01002                                 

Symbol
Herc2, D15F32S1, D15F32S1h, D7H15F32S, D7H15F32S1, D7H15F37S, D7H15F37S1, jdf2, mKIAA0393, r, rjs
Name
(RefSeq) HECT and RLD domain containing E3 ubiquitin protein ligase 2
  KO
K10595  E3 ubiquitin-protein ligase HERC2 [EC:2.3.2.26]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    15204 (Herc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    15204 (Herc2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    15204 (Herc2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    15204 (Herc2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     15204 (Herc2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   15204 (Herc2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    15204 (Herc2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Ubiquitin ligases
     15204 (Herc2)
SSDB
Motif
Pfam: RCC1 RCC1_2 HECT Cul7 MIB_HERC2 ZZ Cyt-b5 ANAPC10 SH3_15 C1_2
Other DBs
NCBI-GeneID: 15204
NCBI-ProteinID: NP_034548
MGI: 103234
Ensembl: ENSMUSG00000030451
Vega: OTTMUSG00000058856
UniProt: Q4U2R1
Position
7 B5; 7 33.42 cM
AA seq 4836 aa
MPSESFCLAAQSRLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTELAQNRELPL
RKDDGVDAQSGTKKEDLNDKEKKEEEETPAPVYRAKSILESWVWGRQPDVNELKECLSVL
VKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSSISVPPTEK
KSARPTGRGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGGVPLQDQHLALAILLELAVQ
RGTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICSKDVPHTESD
MHLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLASLGVMQVACAEKRFLILSRNGRVYTQAYNS
DMLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPK
VISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAG
LKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
IKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPTALPGLDSKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLNLLRLQ
LHAAISHQVDPEFLGLGLGSVLLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLP
TAEERARALSALLPCTVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEASASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLLRNI
ASQTVARLKDVARRISSCLDFEQQSCERSASLDLLLRFQRLLISKLYPGEKIGPISDTSS
PELMGVGSLLKKYTALVCTHIGDILPVAASIASSSWQHFAEVACVMEGDFTGVLLPELVV
SIVLLLSKNASLMQEAGAIPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQ
NCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYGIKDFQTQSLTGNSILAQFAGEDPVV
ALEAALQFEDTQESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASY
LAMSTPLSPVEVECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPISKSRLCS
HRWALGDHSQAFLQAIADNNIQDYNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRL
LLCCLLKHEDLGHVALSLVHVGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQG
RSYKEVCAPVIERLRFLFNELRPAVCSDLSIMSKFKLLGSLPRWRRIAQKIIRERRKKRV
PKKPESIDSEEKIGNEESDLEEACVLPHSPINVDKRPISMKSPKDKWQPLLNTVTGVHKY
KWLKQNVQGLYPQSALLNTIVEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLA
AKSFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLRDVDLIPPFNRMLLEVTFGKLYAWA
VQNIRSVLMDASARFKELGIQPVPLQTITNENPAGPSLGTIPQARFLLVMLSMLTLQHGA
NNLDLLLNSGTLALTQTALRLIGPTCDSVEDDMNASARGASATVLEETRKETAPVQLPVS
GPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMG
KEGKYDLKLVELPVSSQPSAEDSDTEDDSEAEQGERNIHPTAMMLTSVINLLQTLCLSVG
VHADIMQSEATKTLCGLLRMLVESGTTDKPAPPDRLVAREQHRSWCTLGFVRSIALTPQA
CGALSSPRWITLLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMKCLVEK
LFGFLGSLLTTCSSDVPLLRESTLRKRRARPQASLTATHSSTLAEEVVGLLRTLHSLTQW
NGLINKYINSQLCSVTQSYAGKTSERAQLEDYFPDSENLEVGGLMAVLAVIGGIDGRLRL
GGQVMHDEFGEGTVTRITPKGRITVQFCDMRMCRVCPLNQLKPLPAVAFSVNNLPFTEPM
LSVWAELVNLAGSKLEKHKTKKSAKPAFAGQVDLDLLRSQQLKLYILKAGRALLSHQDKL
RQILSQPAVQGTGTLQTDDGAAASPDLGDMSPEGPQPPMILLQQLLSSATQPSPVKAIFD
KQELEAAALALCQCLAVESTHPSSPGCEDCSSSEATTPVSVQHIHLARAKKRRQSPAPAL
PIVVQLMEMGFPRKNIEFALKSLTGTSGNASGLPGVEALVGWLLDHSDVQVTEFSDAETL
SDEYSDEEVVEDVDDTPYPVAAGAVVTESQTYKKRADFLSNDDYAVYVRENVQVGMMVRC
CRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHI
KIGDKVRVKASVTTPKYKWGSVTHQSVGLVKAFSANGKDIIVDFPQQSHWTGLLSEMELV
PSIHPGVTCDGCQTFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQSAVF
CGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHW
IRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININQTDTTVPLLS
DCAEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDDKGS
TGSLIRKKTPGLESTATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAG
GSKSLFAVTVEGKVYSCGEATNGRLGLGMSSGTVPIPRQITALSSYVVKKVAVHSGGRHA
TALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGE
LYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGD
GDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGH
GSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRK
PTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDAD
SSSSSNKISGANNCKPNRPSLAKILLSLEGNLAKQQALSHILTALQIMYARDAVVGALMP
AGMLAPVECPSFSSSAPASDVSAMASPMHMEDSTLAADLEDRLSPNLWQEKREIVSSEDA
VTPSAVTPSAPSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKTSGPEPQSLDEFT
SLLIPDDTRVVVELLKLSVCSRAGDKGREVLSAVLSGMGTAYPQVADMLLELCVTELEDV
ATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVM
DGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKDL
LSDRCVLSCPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQLSALAASHRMWALQRL
RRLLTTEFGQSININRLLGENDGESRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGG
KQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFL
DEVAKKIRELMADSESMDVLHESHSIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWG
HNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLG
IGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSP
CDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVE
ALQGHRVIDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLG
VVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGS
LHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWST
SKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDETGL
GPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPD
GTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLT
PLLIVTPNGRDESGANRDCYLLNPATRAPVHCSMFRFLGVLLGIAIRTGSPLSLNLAEPV
WKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSK
HTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSP
DIPLHLLKSVATYKGIEPSASLVQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRG
RDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYAR
IALTGEPAADDSSEDSDNEDADSFASDSTQDYLTGH
NT seq 14511 nt   +upstreamnt  +downstreamnt
atgccttctgagtctttctgtttggctgcccagtctcgccttgactccaaatggttgaaa
acagatatccagcttgcattcacaagagatggactctgtggtctgtggaacgaaatggtt
aaagatggggaaattgtgtacactggaacagaattagcacaaaatcgagaactccctttg
agaaaagatgatggtgtcgatgctcagagtggaaccaagaaagaagatcttaatgacaaa
gagaagaaggaagaagaagagacacctgcacctgtgtatagagccaagtcaatcctggaa
agctgggtgtggggcaggcagccagatgtgaatgaactgaaggagtgtctttctgtgctg
gttaaagaacagcaagccctggctgtccagtcagctaccactacactctcagccttgagg
ttgaagcagaggctggtgatcctcgagcgctacttcattgccttgaacagaactgttttc
caggagaatgtcaaagttaagtggaaaagcagcagcatttctgtgcctcccacggagaag
aagagtgcccgtcccacaggcagaggggtagaaggtcttgcccgagtcggatcccgagca
gcactctccttcgcctttgctttcttacggagggcctggcgttcaggtgaggatgcggat
ctctgcagtgagctcttgcaggagtccctggatgcccttcgagctcttcctgaagcctcc
ctctttgatgagagcacagtatcctctgtgtggttggaggtggtagagagagcaacgagg
ttcctcaggtctgtcgtgactggagatgttcatggaacaccagggaccaaggggccagga
ggagttcctctacaggatcagcacttggctttggccattctactggagttggctgtccag
agaggcacgcttagccaaatgttgtctgccatcctgttgttgcttcagctgtgggacagt
ggggcacaggaaacagataatgagcgctctgcccagggcaccagtgctcctcttttgcct
ctgctgcagaggtttcagagcatcatctgcagtaaggacgtgccacacacagagagcgac
atgcatcttttatctggccctttaagccccaatgagagtttcctaaggtaccttactctt
ccacaagacaatgaacttgccattgatttacgacaaactgcagttgttgtcatggctcat
ctagaccgtctggctacaccctgtatgcctcctctgtgtagctctccaacatctcataag
ggatcattgcaggaggtcataggttgggggttaataggctggaaatactatgcgaatgtg
attggtccgatccagtgtgaaggccttgccagtctgggggtaatgcaggtcgcctgtgca
gaaaagcggttcttgatcttgtcccgcaatggtcgtgtatacacacaggcttacaacagt
gacatgctggctccacagctggtccagggtcttgcctccagaaacattgtgaaaattgct
gcccattctgatggtcaccactatctggctttggctgccacgggggaggtgtactcctgg
ggctgtggagatggcggaaggctgggccatggggacacagtgcctctggaggagcccaag
gtgatctcggctttctcaggaaagcaggctgggaagcacgtggtgcacatagcatgtggg
agcacgtacagtgcggccatcactgccgagggggagctgtacacttggggccgtgggaac
tacggccgcttgggccatggctctagtgaagatgaggccattccaatgctggtagctgga
ctcaaaggtctaaaggtcattgatgttgcctgtgggagtggagatgctcaaaccctggcc
gtgactgagaacggccaagtgtggtcttggggagatggcgactatgggaagttgggcaga
ggtggaagtgatggctgcaaaaccccaaagctgattgaaaaacttcaagacttagatgtc
atcaaagtgcgctgtggaagtcagttttctattgccttgacaaaagatggccaagtttat
tcatgggggaaaggtgacaatcagaggcttggtcatggaacagaagaacatgtccgttat
cccaaactcttggaaggtttgcaagggaagaaggtgattgatgtggctgcaggctccacg
cactgccttgctctgacagaagacagtgaggtgcacagctgggggagcaatgatcagtgc
cagcactttgacactttgcgtgtgaccaagccagaaccgactgcactcccaggactggac
agcaaacacatagttggaatcgcttgtgggcctgcccagagctttgcgtggtcatcttgt
tctgagtggtccattggccttcgtgtcccttttgtagtggacatctgctcaatgacgttt
gagcagctggatctcctgctgcgtcaggtcagtgaggggatggacggcactgctgactgg
cccccaccacaagagaaggagtgcatggctgtggcaacgctgaaccttctgcgactgcag
ttgcatgctgccattagtcaccaggttgacccggaattccttggtttaggtctgggcagt
gtgctcctgaacagcctgaagcagaccgtggtgaccctggccagcagtgcaggagtgctg
agcactgtgcagtcagctgcccaggctgtactacagagcggctggtctgtgctgctgccc
acagctgaggagcgggccagggcactctcagcactcttgccctgcacagtttcaggcaat
gaagtgaatataagtccaggtcgtcgattcatgattgatcttttagttggcagcttgatg
gctgatggaggattggagtcagctttaaatgcagccattactgcagaaattcaggatata
gaagccaaaaaagaagcacagaaggaaaaagaaattgatgaacaagaagccagtgcctcc
acatttcatagaagtaggactcctctggataaagacctaattaatactgggatctatgaa
tcatctggcaaacagtgcttgcctctagttcaactcatacagcagcttcttagaaacatt
gcttctcagactgtagccagactgaaagatgttgctcgccgcatttcctcatgtctggac
tttgagcagcagagttgtgaaagatcggcttcactggatctgttgctgcgctttcaacgc
ctgctcattagtaaactttacccaggagagaagattggtccaatctcagatacttccagt
cctgagctaatgggtgttggctctttgctgaaaaagtacacagcccttgtgtgtacacac
attggagacatattgcctgtggctgccagcatcgcttctagcagctggcagcactttgca
gaagtggcctgcgtaatggaaggggactttacaggtgtactccttccggagctagtggtg
tccatcgtgcttctgctcagtaagaacgccagcctaatgcaagaggctggagctatacct
ctgcttggaggcctcctggagcacctggatcgtttcaaccatttagcaccagggaaggag
cgggatgatcatgaagagctggcctggcctgggattatggagtcatttttcactggtcag
aactgtagaaataatgaggaggtaacactgatacgcaaagctgatttggagaaccataat
aaagatggtggcttctggactgtaattgatggaaaagtatatggtataaaagactttcag
acacaatccttaacaggaaatagtatactggctcagtttgcaggggaagatccagtggtc
gctctggaggcagctttgcagtttgaagacacacaggaatccatgcatgccttctgtgtt
ggccagtatttggagcctgaccaagaagttgttaccataccagatcttggaagtttgtct
tcaccactgattgacacagagaggaacctgggcctacttcttggattgcatgcttcttat
ttagcaatgagcacaccactatctcctgtggaggttgaatgcgccaagtggctgcagtca
tcgattttttctgggggtctgcagaccagccagattcactacagctacaatgaagagaaa
gatgaggaccactgtagctctcctgggggcacacccatcagcaagtcccgactgtgttct
cacagatgggccttgggtgatcattctcaggctttcctgcaagccattgcagacaataac
atccaggactacaatgtgaaggactttctgtgtcaaattgaaaggtactgtagacagtgc
cacttgactacacccatcacgtttcctcctgagcatcctgtggaagaggttggccgtctt
ctgttatgctgcctcttaaaacatgaagatttaggtcatgtggcattatctttagttcat
gtaggtacacttggtattgagcaagtaaagcacagaacattgcctaaatctgttgtggat
gtgtgtagagttgtctaccaagcaaaatgctcactcattaagactcatcaagaacagggc
cgttcctacaaggaggtgtgtgctcctgtcattgaacgcttgagatttctcttcaatgaa
ttgaggcctgctgtttgtagtgacctctctataatgtctaagtttaagctgttaggttca
ttaccacgttggaggaggatagctcagaagatcattcgagaaagaaggaaaaagagagtt
cctaagaaaccagaatctattgatagtgaagaaaaaattggaaatgaagagagtgattta
gaagaagcttgtgttttgcctcatagtcctataaatgtagacaaaagacctatttctatg
aagtctcccaaggataaatggcaaccattgttgaatacagttacaggggttcataaatat
aaatggttaaagcaaaatgtacagggcctttacccacagtctgcactcctcaatacaatt
gttgaatttgcccttaaagaagagccagtagatgtggaaaaaatgcggaagtgcctccta
aaacagttggaaagagcagaggttcgtctggaagggatagatacaattctgaaactggca
gccaaaagttttttacttccttctgtgcagtatgctatgttttgtggatggcaaagactt
attcctgaaggaattgatataggggaaccacttacagactgtttgagggatgtggatttg
atcccaccatttaatcggatgctgctggaagtgacttttggcaagctgtatgcttgggca
gttcagaatattcgatctgttctgatggatgcaagtgccaggtttaaagagctgggtatc
cagcctgttcccctacaaaccattaccaatgagaacccggcgggaccaagtctgggtacc
atcccacaagctcgatttcttctggtgatgctcagcatgctcaccctgcagcatggtgca
aacaaccttgacctcctgctcaactcaggcacgctggcactcactcagacagccctaagg
ctgatcggtcctacttgtgacagtgttgaggacgacatgaatgcgtctgcccggggagcc
tctgctacagtgttggaagaaacaaggaaggaaacggctcctgttcagctccctgtttca
gggccagaactggctgctatgatgaagattggaaccagggtcatgagaggggtggattgg
aagtggggtgaccaggatgggcctcccccaggtctaggccgggtaattggtgagctgggc
gaggatggctggatcagggtccagtgggacacaggcagcactaactcatacaggatggga
aaagaaggaaaatatgacctcaagctggtggagctgcctgtgtcatcacagccctctgca
gaggattcagacacagaggatgactccgaagcagagcaaggtgagaggaatattcacccc
acagcgatgatgctgaccagcgttattaacttactgcaaaccctgtgtctctctgttgga
gtccatgctgacatcatgcagagcgaggccaccaagactttgtgtggactacttcgaatg
ttagtagaaagtggaacaacagataagccagctcctccagacagactggtggcccgggag
cagcaccggagctggtgtacactgggcttcgtccgcagcattgccctcaccccacaggcc
tgtggtgctctcagctccccaaggtggatcacactgctcatgaaggttgtggaaggccac
gcaccgttcactgctgcctccctgcagaggcagatcttagctgttcatttgctacaagca
gttcttccatcatgggacaagacagaaagggcacgggacatgaagtgtcttgtggaaaag
ctgtttggcttcttgggcagtttgcttactacttgttcttctgatgttccgttacttaga
gaatccacgttgagaaagcggagggcccggccccaggcttccttgactgccacccacagc
agcacgctggctgaagaagtggtggggctgctccgcactctgcactccctgacccagtgg
aatggcctcatcaacaaatacattaactcccagctttgctctgtcacacaaagctatgcc
ggaaagacatcagaaagggcccagctagaagattacttcccagactctgagaaccttgaa
gtgggaggcctcatggcagtcctcgctgtcattggagggattgatggccgtctgcgcctg
ggaggccaggtcatgcatgatgagtttggagagggcacagtgactcgcatcactccgaag
ggcagaatcaccgtgcagttctgtgacatgcggatgtgccgagtttgcccactgaatcag
ctcaaaccgctccctgctgtggcctttagtgtgaacaatttgcctttcacggagcctatg
ctttctgtctgggctgagttggtgaatcttgctggaagcaaattggaaaagcacaaaaca
aagaagtcagcaaaaccggcctttgcagggcaagtagacttggacctgctgcggagccag
cagttaaagctgtacatcctgaaagcagggcgggcactgctttcccaccaagacaagctg
aggcagatactatctcagcccgcggttcaggggactggaactcttcagacagatgatgga
gcagctgcatcccctgaccttggggatatgtcacctgaagggccacagcctcccatgatc
ctccttcagcagttactgtcctcagccactcagccatctcctgtgaaggcaatatttgat
aaacaggaacttgaggctgctgctttggctctctgtcagtgtttggctgtggaatccaca
catccttcaagtccagggtgtgaagactgcagctccagtgaggccacaaccccagtctct
gtacagcacatccatcttgccagggcgaagaagcgcagacagtccccagcccctgctctg
cctattgtagtgcagctcatggaaatgggatttccaaggaaaaatatagagtttgctctg
aagtcgctcaccggcacctctgggaatgcatctggtttgcctggtgtggaagccttggtt
gggtggctgctagaccactctgatgtccaggttacagagttctcggatgcagaaacacta
tctgacgagtattcagacgaggaggtggtagaagatgtggatgataccccttaccctgtg
gctgcgggtgctgttgtgactgagagccagacttacaagaagcgtgctgatttcctgagc
aatgatgattatgccgtgtatgtgagagagaacgttcaggtgggaatgatggtgagatgc
tgtcgaacatatgaagaagtatgtgaaggtgatgtgggcaaagtcatcaaactggataga
gatggattacatgaccttaatgttcagtgtgattggcagcagaaaggcggcacttactgg
gttaggtatattcatgttgaacttataggctatcctccaccaagttcttcttctcacatc
aagatcggtgataaagtacgggtcaaagcttctgttaccacaccaaagtacaagtgggga
tccgtcactcatcaaagtgtggggcttgtgaaagctttcagtgccaatgggaaagacatc
attgtggacttcccccagcagtcccactggactgggttgctgtcagaaatggagttggtg
cctagtattcatccaggggttacgtgtgacggctgtcagacttttcctatcaatggatcc
agattcaaatgtagaaactgtgatgactttgatttttgtgaaacatgtttcaagacaaaa
aaacacaacaccaggcatactttcggcaggattaatgagccagggcagtctgcagtgttt
tgtggccgttctggaaagcagctgaaacgatgtcacagcagtcagcctggaatgctcctg
gacagctggtcccgaatggtgaaaagcctgaacgtttcatcctctgtaaaccaggcttct
cgtctcattgatggcagtgagccctgctggcagtcatctgggtcacaaggaaagcattgg
attcgtttggagatttttccagatgttcttgttcatagattaaaaatgatcgtggatcca
gcggacagtagctacatgccatccctggtcgtggtgtcaggtggaaattccttaaataac
ctaattgaactaaagacaattaatatcaaccaaactgacaccactgtacccctgctaagt
gactgtgcagagtatcacaggtacattgagattgcaataaaacagtgcaggagctcagga
atcgactgcaaaatccacggtctcatcctgcttggccgcatccgtgctgaagaggaggac
ctggctgcagttccttttttggcttcagacaatgaggaggaggaggatgataagggcagc
actgggagtcttattagaaagaagactccagggttggaatcaacagctacaataagaacc
aaagtgtttgtgtggggactgaatgacaaggaccagcttggtggccttaaaggctcgaag
ataaaggttccttcattctctgagactctgtctgccctgaatgtggttcaggtggctggt
ggttctaagagcttgtttgcagtgactgtggaagggaaggtgtattcttgtggagaagcc
acaaatggccgcctaggtctgggtatgtccagtgggacggttcctattcctcggcagatt
acagccctcagcagctacgtggtcaagaaggtagcagttcactcaggtggccggcatgct
acagccttaaccgtggatgggaaggtgttttcatggggtgaaggtgatgatgggaaactt
ggacacttcagcagaatgaactgtgacaagccaaggctcatagaggctctgaaaaccaag
cgtatcagggacatagcctgcgggagttctcatagtgcagccctgacatccagtggggaa
ctgtacacttggggccttggagagtatggccgattgggacatggggataatacaacacag
ctgaagcccaaaatggtaaaagtccttcttggtcaccgagtaatccaggttgcgtgtgga
agcagagatgcacagacactggctctgaccgatgaaggtttggtgttttcttggggtgat
ggtgattttggaaaattgggccgaggaggaagtgaaggctgtaatattccccagaacatt
gagagactaaatggccagggggtgtgccagattgagtgtggagctcagttttccttggca
ctcaccaagtcaggagtggtgtggacgtgggggaagggcgactacttcagactgggccat
ggctctgatgtccatgtgcgcaagccacaggtggtggaaggactgagagggaaaaagatt
gtgcatgtggcagttggagccctgcattgcctagcagtcacagactcagggcaggtgtat
gcttggggggacaatgaccatggccaacaaggcaatggcacaaccacagttaacagaaag
ccaacccttgtgcaaggcctggaaggccagaagatcacgcgagtggcttgtgggtcatca
catagtgtagcatggacaacagtggatgtagctacaccatctgtccatgagcctgtcctc
ttccagactgcaagagacccgctaggtgcttcttacttaggtgtcccttcggatgctgat
tcttcttcttccagcaataagattagtggtgcaaataactgtaagcctaatcgcccttct
cttgccaagatcctcctgtcactggaaggaaacctggccaagcagcaggccttatctcac
atccttacagcactgcagatcatgtatgccagagatgcagtggttggagccttgatgcca
gccggcatgctcgccccagtggaatgcccctcattctcctcgtcagcgcctgcctctgat
gtgtcagccatggccagtcccatgcatatggaggacagcacgctagctgctgaccttgag
gacagactgagtccaaatctgtggcaagaaaagagagagatcgtctcctctgaggatgct
gtgaccccctctgcagtgacaccgtctgctccctcagcctcctctcgcccatttatccca
gtgacagatgacccaggagctgccagcatcattgcagaaaccatgactaaaaccaaagag
gatgttgaaagccaaaataaaacatcaggcccagagccccagtccttggatgagttcacc
agtctgctgatccctgatgacacccgggtggtggtggagctgctcaagctgtcagtgtgc
agcagggctggagacaagggcagggaagtgctttctgctgtgctgtccggcatgggcact
gcctacccacaggtggcagacatgctgttggagctctgtgtcaccgagttagaagatgtg
gccacagactcacagagtggccgtctttcctcccagcctgtggtggtagagagtagccat
ccctatacagacgacacctccaccagtggtacagtgaagataccaggtgcagaaggactc
agggtggagtttgaccggcagtgctccacagagaggcgccacgatcctctcactgtcatg
gatggtgtcaacaggattgtgtcggtgcggtcaggtcgagaatggtctgactggtcgagt
gagcttcgcatccctggagatgagctgaaatggaagttcatcagtgatgggtctgtgaat
gggtggggctggcgcttcacagtttatcccatcatgccagctgcaggccctaaggacctc
ctctcggatcgctgtgtcctctcatgtccatccatggacctggtgacctgtctcttggac
ttccgactcaatctcacctccaacagaagcatcgtccctcgccttgctgcctctctggct
gcgtgtgctcagctgagcgccctagctgccagccacagaatgtgggctcttcagagactg
aggagactgctcaccacagaatttgggcagtcaattaacataaacaggctgctgggagaa
aatgatggggaatccagagctttgagttttacaggcagtgcccttgctgctttggtgaaa
ggccttccagaagctttgcagaggcagtttgagtatgaagatcctattgtgagaggtggc
aaacagctgctccatagtccattctttaaggtgctagtagctcttgcttgtgacctggaa
ttagacacactcccttgctgcgcagagacccataaatgggcttggttccgaagatactgc
atggcctcccgagttgctgtggccctggacaaaagaacaccattgcctcgtctgtttctt
gatgaggttgctaagaagattcgtgaattaatggcagacagtgaaagtatggatgttctc
catgaaagccacagcatctttaaaagagagcaagatgagcaacttgtgcagtggatgaac
aggcgaccagatgactggactctttctgctggtggtagtggaaccatttatgggtggggg
cataatcataggggacagcttggaggaattgaaggtgcaaaagtaaaagttcccactcca
tgtgaagcacttgcgactctcagacctgtgcagttaattggaggagagcagacactattt
gctgtgacagctgatgggaagctctatgctactggctatggtgctggtggaaggctgggg
attggagggacagagtcagtgtctactccaacgttactggagtccattcagcatgtgttc
attaagaaagttgctgtgaactcaggaggaaagcattgccttgctctctcttcagaaggc
gaagtttactcttggggcgaggcagaagatgggaagttgggacatggcaacagaagtcca
tgtgaccgccctcgtgtcattgaatccctgagaggaattgaagtggttgatgttgctgct
ggtggagcccatagtgcctgtgtcacagcagctggagacctctacacatggggcaaaggc
cgatatggccgcctggggcacagtgacagtgaggaccagttaaagccaaaactggtggaa
gcactacagggccatcgtgtcatagacattgcgtgtggcagtggggatgcccagacactg
tgcctcactgatgacgatactgtctggtcctggggagatggagactatggcaagcttggc
agaggaggcagtgatggttgcaaagtgcccatgaagattgattctctcactggccttgga
gtagttaaagtggaatgtggatctcagttttctgtcgcccttaccaagtctggagctgtt
tatacatggggtaaaggtgattatcaccggctgggccatggatccgatgaccacgttcga
agacctcggcaggttcaaggactgcaggggaagaaagtcattgctattgccactggctcc
ctgcactgtgtgtgttgcacagaggatggtgaagtttacacatggggtgacaatgatgag
gggcagctaggagatggaacaacaaatgctattcagagaccacgattggtagctgccctt
cagggtaagaaggttaatcgagtggcctgtggttctgcacacacccttgcctggtcaacc
agcaagccagcgagcgccggcaagctccctgcacaggtacccatggagtacaaccattta
caagagatccccatcattgctctacggaaccgactgctgctgctgcatcacatctcagag
ctcttttgtccctgcatccccatgtttgacctagagggctctcttgatgaaactggactc
gggccttcagttgggtttgacacactccgtgggatcttaatatctcagggcaaggaagca
gctttcaggaaggtagtacaagcaactatggtgcgagatcgccaacatgggcctgtggtg
gagctgaaccgcatccaggttaaacgctcccggagtaaaggtgggttagctggccctgat
ggcaccaagtctgtctttgggcagatgtgtgctaagatgagttccttcagtcctgacagc
cttctccttcctcaccgagtctggaaagtcaagtttgtgggtgaatccgtggacgactgt
ggtggtggctacagtgagtctatagcagagatttgtgaggagctgcaaaacggactcaca
cctcttctgattgtgactcccaatggcagggatgagtctggtgccaacagagactgttac
ctattaaaccctgccacccgtgcacccgtgcactgcagcatgttccgattcctaggggtg
ttattgggcattgccatccgaactgggagtccactaagtttgaatcttgctgaacctgta
tggaagcagctggctgggatgagcctcaccattgcagacctgagtgaggtagataaagat
tttattcctgggcttatgtacattcgtgacaatgaagccacttcagaggaatttgaggct
atgagcctgcccttcaccgtgccaagtgccagtggccaggatatccagctgagctctaag
cacacgcacatcaccctggacaaccgtgcagaatatgtccggctggcaataaactacaga
ctccatgaatttgatgaacaagtagctgctgtccgggaagggatggctcgagttgtacct
gtaccccttctctctcttttcactggatacgaactggagacaatggtctgtgggagccca
gatatcccactgcatcttttaaagtcagtggcaacgtataaagggattgagccttctgca
tccttggtccagtggttctgggaagtgatggaatctttctctaacacggaacgctccctc
tttcttcgctttgtgtggggcaggacaaggctgcccaggaccattgctgacttccggggc
agagactttgtcatccaggtcttggataaatacaaccctcctgatcacttcctcccagaa
tcctacacatgcttctttctgctcaagctgcccaggtattcctgtaagcaggtgcttgag
gaaaagctgaagtatgccatccacttttgcaaatccatagacacagatgactatgctcgc
atagctctcactggagagcccgctgccgatgacagcagtgaggactcagataatgaggac
gccgactcttttgcttcagactctacacaagactacttgacaggacactaa

DBGET integrated database retrieval system