KEGG   Mus musculus (mouse): 15205Help
Entry
15205             CDS       T01002                                 

Gene name
Hes1, Hry, bHLHb39
Definition
(RefSeq) hes family bHLH transcription factor 1
  KO
K06054  hairy and enhancer of split 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03460  Fanconi anemia pathway
mmu04330  Notch signaling pathway
mmu04950  Maturity onset diabetes of the young
mmu05165  Human papillomavirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    15205 (Hes1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    15205 (Hes1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15205 (Hes1)
  09162 Cancer: specific types
   05224 Breast cancer
    15205 (Hes1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    15205 (Hes1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    15205 (Hes1)
   05165 Human papillomavirus infection
    15205 (Hes1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15205 (Hes1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    15205 (Hes1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    15205 (Hes1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     15205 (Hes1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hairy_orange HLH
Motif
Other DBs
NCBI-GeneID: 15205
NCBI-ProteinID: NP_032261
MGI: 104853
Ensembl: ENSMUSG00000022528
Vega: OTTMUSG00000035113
UniProt: P35428 Q3UZZ2
Position
16 B2; 16 21.09 cM
AA seq 282 aa AA seqDB search
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPAGPQHA
PFAPPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAF
AHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTSDSMWRPWRN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaattcctcctccccggtggctgctaccccagccagt
gtcaacacgacaccggacaaaccaaagacggcctctgagcacagaaagtcatcaaagcct
atcatggagaagaggcgaagggcaagaataaatgaaagtctaagccaactgaaaacactg
attttggatgcacttaagaaagatagctcccggcattccaagctagagaaggcagacatt
ctggaaatgactgtgaagcacctccggaacctgcagcgggcgcagatgaccgccgcgctc
agcacagacccgagcgtgttggggaaataccgcgccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgtgagggcgttaacaccgaggtgcgcactcggctgctg
ggccacctggccaactgcatgacccagatcaacgccatgacctaccccgggcaggcgcac
cccgccttgcaggcgccgccgccgccgcccccgtcaggacctgccggtccccagcacgcg
ccattcgcgccgccgccgccgccgcttgtgcccatccccgggggcgcggcgccccctccc
ggcagcgcaccctgcaagttgggcagccaggctggagaggctgccaaggtttttggcggc
ttccaagtggtgccggctcctgacggccaatttgcctttctcatccccaacggggccttc
gctcacagcggcccggtcatcccggtctacaccagcaacagtgggacctcggtgggtcct
aacgcagtgtcaccttccagtggctcctcgctcacttcggactccatgtggagaccgtgg
cggaactga

DBGET integrated database retrieval system