KEGG   Mus musculus (mouse): 15209Help
Entry
15209             CDS       T01002                                 

Gene name
Hesx1, HES-1, Rpx
Definition
(RefSeq) homeobox gene expressed in ES cells
  KO
K09354  homeobox protein expressed in ES cells 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    15209 (Hesx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15209 (Hesx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, XANF
    15209 (Hesx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 15209
NCBI-ProteinID: NP_034550
MGI: 96071
Ensembl: ENSMUSG00000040726
Vega: OTTMUSG00000037602
UniProt: Q61658
Position
14; 14 A3
AA seq 185 aa AA seqDB search
MSPSLREGAQLRESKPAPCSFSIESILGLDQKKDCTTSVRPHRPWTDTCGDSEKGGNPPL
HAPDLPSETSFPCPVDHPRPEERAPKYENYFSASETRSLKRELSWYRGRRPRTAFTQNQV
EVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQFLMAKKPFN
PDLLK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccagccttcgggaaggtgctcagctccgggaaagcaagcccgcgccctgctcc
ttctcaattgagagcattttaggactggaccagaaaaaagattgtacaacgtcagtaaga
ccccacagaccctggacagacacctgcggtgactcagagaaaggtggcaacccaccccta
catgccccagatcttcccagtgagacttcatttccttgtccagtggatcatccaaggcca
gaagaaagggctccgaaatatgaaaattatttttcagcctccgaaacacgctctttgaaa
agagaattgagttggtaccgaggacgaaggccaagaaccgctttcacccagaaccaggtc
gaagtattggaaaatgtctttagagtgaactgctaccctggcattgacatcagagaggac
ctagctcaaaagctgaacttagaggaagacagaatccagatttggttccaaaatcgccga
gcaaagatgaaaaggtcccgtagagaatcacagtttctaatggcgaaaaaacccttcaac
ccagatcttctgaaatag

DBGET integrated database retrieval system