KEGG   Mus musculus (mouse): 15211Help
Entry
15211             CDS       T01002                                 

Gene name
Hexa, Hex-1
Definition
(RefSeq) hexosaminidase A
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00511  Other glycan degradation
mmu00513  Various types of N-glycan biosynthesis
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu00531  Glycosaminoglycan degradation
mmu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mmu00604  Glycosphingolipid biosynthesis - ganglio series
mmu01100  Metabolic pathways
mmu04142  Lysosome
Module
mmu_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    15211 (Hexa)
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    15211 (Hexa)
   00531 Glycosaminoglycan degradation
    15211 (Hexa)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    15211 (Hexa)
   00604 Glycosphingolipid biosynthesis - ganglio series
    15211 (Hexa)
   00511 Other glycan degradation
    15211 (Hexa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    15211 (Hexa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15211 (Hexa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     15211 (Hexa)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   15211 (Hexa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 15211
NCBI-ProteinID: NP_034551
MGI: 96073
Ensembl: ENSMUSG00000025232
Vega: OTTMUSG00000063295
UniProt: P29416
Position
9 B; 9 32.02 cM
AA seq 528 aa AA seqDB search
MAGCRLWVSLLLAAALACLATALWPWPQYIQTYHRRYTLYPNNFQFRYHVSSAAQAGCVV
LDEAFRRYRNLLFGSGSWPRPSFSNKQQTLGKNILVVSVVTAECNEFPNLESVENYTLTI
NDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHY
LPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVK
EVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYSGSHLSGTFGPVNPSLNSTYDF
MSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGFTDFKQLESFYIQTLLD
IVSDYDKGYVVWQEVFDNKVKVRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWY
LNRVKYGPDWKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVA
ERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPISVGYCEQEFEQT
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggccggctgcaggctctgggtttcgctgctgctggcggcggcgttggcttgcttggcc
acggcactgtggccgtggccccagtacatccaaacctaccaccggcgctacaccctgtac
cccaacaacttccagttccggtaccatgtcagttcggccgcgcaggcgggctgcgtcgtc
ctcgacgaggcctttcgacgctaccgtaacctgctcttcggttccggctcttggccccga
cccagcttctcaaataaacagcaaacgttggggaagaacattctggtggtctccgtcgtc
acagctgaatgtaatgaatttcctaatttggagtcggtagaaaattacaccctaaccatt
aatgatgaccagtgtttactcgcctctgagactgtctggggcgctctccgaggtctggag
actttcagtcagcttgtttggaaatcagctgagggcacgttctttatcaacaagacaaag
attaaagactttcctcgattccctcaccggggcgtactgctggatacatctcgccattac
ctgccattgtctagcatcctggatacactggatgtcatggcatacaataaattcaacgtg
ttccactggcacttggtggacgactcttccttcccatatgagagcttcactttcccagag
ctcaccagaaaggggtccttcaaccctgtcactcacatctacacagcacaggatgtgaag
gaggtcattgaatacgcaaggcttcggggtatccgtgtgctggcagaatttgacactcct
ggccacactttgtcctgggggccaggtgcccctgggttattaacaccttgctactctggg
tctcatctctctggcacatttggaccggtgaaccccagtctcaacagcacctatgacttc
atgagcacactcttcctggagatcagctcagtcttcccggacttttatctccacctggga
ggggatgaagtcgacttcacctgctggaagtccaaccccaacatccaggccttcatgaag
aaaaagggctttactgacttcaagcagctggagtccttctacatccagacgctgctggac
atcgtctctgattatgacaagggctatgtggtgtggcaggaggtatttgataataaagtg
aaggttcggccagatacaatcatacaggtgtggcgggaagaaatgccagtagagtacatg
ttggagatgcaagatatcaccagggctggcttccgggccctgctgtctgctccctggtac
ctgaaccgtgtaaagtatggccctgactggaaggacatgtacaaagtggagcccctggcg
tttcatggtacgcctgaacagaaggctctggtcattggaggggaggcctgtatgtgggga
gagtatgtggacagcaccaacctggtccccagactctggcccagagcgggtgccgtcgct
gagagactgtggagcagtaacctgacaactaatatagactttgcctttaaacgtttgtcg
catttccgttgtgagctggtgaggagaggaatccaggcccagcccatcagtgtaggctac
tgtgagcaggagtttgagcagacttga

DBGET integrated database retrieval system