KEGG   Mus musculus (house mouse): 15214
Entry
15214             CDS       T01002                                 
Symbol
Hey2, CHF1, Herp1, Hrt2, bHLHb32, hesr2
Name
(RefSeq) hairy/enhancer-of-split related with YRPW motif 2
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    15214 (Hey2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15214 (Hey2)
  09162 Cancer: specific types
   05224 Breast cancer
    15214 (Hey2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    15214 (Hey2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15214 (Hey2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    15214 (Hey2)
SSDB
Motif
Pfam: HLH Hairy_orange HTH_Crp_2
Other DBs
NCBI-GeneID: 15214
NCBI-ProteinID: NP_038932
MGI: 1341884
Ensembl: ENSMUSG00000019789
UniProt: Q9QUS4 Q0VGJ1
Position
10:complement(30708355..30718779)
AA seq 339 aa
MKRPCEETTSESDLDETIDVGSENNYPGHATSSVMRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALATD
FMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHLSTCASQREAAVMTSSMAHHHHPL
HPHHWAAAFHHLPTALLQPNGLHTSESTPCRLSTSSEVPSAHGSALLTATFAHADSALRM
PSGGTVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPSNAAAAAAVA
AATAISPPLSVSAASSPQQTSTGTNNKPYQPWGTEVGAF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaagcgcccttgtgaggaaacgacctccgaaagcgacctggacgagaccatcgacgtg
gggagcgagaacaattaccctgggcacgctacaagctcagtgatgaggtccaattcaccg
acaactacctctcagattatggcaagaaagaaaaggagagggatcatagaaaaaaggcgt
cgggatcgaataaataacagtttatctgaattgagaagactagtgccaacagcttttgaa
aaacaaggatctgccaagttagaaaaggctgaaatattgcaaatgacagtggatcatttg
aagatgctccaggctacagggggtaaaggctactttgatgcccatgctcttgccacagac
ttcatgagcattggattccgagagtgcttgacagaagtggctaggtacctaagctcagtg
gaaggccttgacccgtcggacccactacgcgtgcgccttgtctctcatctcagcacctgt
gcctcccagcgggaggcagcagtgatgacatcctccatggcccaccaccatcaccccttg
caccctcaccactgggcagctgctttccaccatctccccacagccctgctccagcccaat
ggactccacacatcagagtcaaccccatgtcgcctatccacatcttcagaagtgccttct
gctcatggctctgctctcctcacagcaacgtttgcccatgcagattctgctcttcggatg
ccatcagggggcaccgttgcaccctgcgtgccacctctctccacctctcttctgtctctt
tcggccactgtgcatgccgcagctgcagcagccactgcagctgcacacagcttccctctg
tccttcgcaggggcttttcccatgctcccgtccaatgcagcggcagcagccgctgttgct
gctgcaacagcaatcagcccacccttgtcggtatccgcagcctccagtcctcagcagaca
agcactgggacaaacaataaaccttaccaaccctgggggacagaagttggagccttttaa

DBGET integrated database retrieval system