KEGG   Mus musculus (mouse): 15235
Entry
15235             CDS       T01002                                 

Symbol
Mst1, D3F15S2h, D9H3F15S2, DNF15S2h, Hgfl
Name
(RefSeq) macrophage stimulating 1 (hepatocyte growth factor-like)
  KO
K23441  hepatocyte growth factor-like protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    15235 (Mst1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    15235 (Mst1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   15235 (Mst1)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 PAN_2
Other DBs
NCBI-GeneID: 15235
NCBI-ProteinID: NP_032269
MGI: 96080
Ensembl: ENSMUSG00000032591
Vega: OTTMUSG00000033726
UniProt: P26928 Q3UZ05
Position
9 F1; 9 59.07 cM
AA seq 716 aa
MGWLPLLLLLVQCSRALGQRSPLNDFQLFRGTELRNLLHTAVPGPWQEDVADAEECARRC
GPLLDCRAFHYNMSSHGCQLLPWTQHSLHTQLYHSSLCHLFQKKDYVRTCIMDNGVSYRG
TVARTAGGLPCQAWSRRFPNDHKYTPTPKNGLEENFCRNPDGDPRGPWCYTTNRSVRFQS
CGIKTCREAVCVLCNGEDYRGEVDVTESGRECQRWDLQHPHSHPFQPEKFLDKDLKDNYC
RNPDGSERPWCYTTDPNVEREFCDLPSCGPNLPPTVKGSKSQRRNKGKALNCFRGKGEDY
RGTTNTTSAGVPCQRWDAQSPHQHRFVPEKYACKDLRENFCRNPDGSEAPWCFTSRPGLR
MAFCHQIPRCTEELVPEGCYHGSGEQYRGSVSKTRKGVQCQHWSSETPHKPQFTPTSAPQ
AGLEANFCRNPDGDSHGPWCYTLDPDILFDYCALQRCDDDQPPSILDPPDQVVFEKCGKR
VDKSNKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCIWSCHEPLTGYE
VWLGTINQNPQPGEANLQRVPVAKAVCGPAGSQLVLLKLERPVILNHHVALICLPPEQYV
VPPGTKCEIAGWGESIGTSNNTVLHVASMNVISNQECNTKYRGHIQESEICTQGLVVPVG
ACEGDYGGPLACYTHDCWVLQGLIIPNRVCARPRWPAIFTRVSVFVDWINKVMQLE
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggggtggctcccacttctgctgcttctggtacagtgttcaagggctcttgggcagcgc
tcaccactgaatgacttccagctgttccggggcacagagttaaggaacctgttacacaca
gcggtgccggggccatggcaggaggatgtggcagatgctgaggagtgtgctaggcgctgt
gggccccttctggactgtcgggccttccactacaacatgagcagccatggttgccagctg
ctgccgtggacccagcactcgctgcacacacagctataccactcgagtctgtgccatctc
ttccagaagaaagattatgtgcggacctgcattatggacaatggggtcagctaccggggc
actgtggccaggacagctggtggcctgccctgccaagcctggagtcgcaggttccccaat
gaccacaagtatacgcccacgccaaagaatggcctggaagagaacttctgtaggaaccct
gatggggatcccagaggtccctggtgctacacaacaaaccgcagtgtgcgtttccagagc
tgtggcatcaaaacctgcagggaggctgtttgtgttctgtgcaacggtgaggattaccgt
ggcgaggtagacgttacagagtcagggcgggagtgtcaacgctgggacctgcagcacccc
cactcgcaccctttccagcctgaaaagttcctagacaaagatctgaaagacaactattgt
cgtaatccggacggatctgagcggccctggtgctacaccacagacccgaatgttgagcga
gaattctgcgacctgcccagttgcgggcctaacctgcctccgaccgtcaaaggatccaag
tcacagcggcgcaacaagggcaaggctcttaactgcttccgcggaaaaggtgaagactat
cgaggcacaaccaataccacctctgcgggcgtgccctgccagcggtgggatgcgcagagt
ccacaccagcaccgctttgtgccagagaaatatgcttgcaaggaccttcgtgagaatttc
tgccggaatcctgatggctccgaggcgccttggtgcttcacatctcgacctggtttgcgc
atggccttctgccaccagatcccacgctgcactgaagaactggtgccagagggatgctac
cacggctcaggtgaacagtatcgtggctcagtcagcaagacgcgcaagggcgttcagtgc
cagcactggtcctctgagacaccgcacaagccacaatttacacccacctcggcaccgcag
gcgggactggaggccaacttctgcaggaatcctgatggggatagccatgggccctggtgc
tataccttggacccggatatcctgtttgactactgtgccctacagcgctgtgatgatgac
cagccaccatccattctggaccccccagaccaggtggtgtttgaaaagtgtggcaagaga
gttgacaagagtaataaacttcgtgtggtgggaggccatcctgggaactccccatggacg
gtcagcttgcggaatcgacagggccagcatttctgtgggggctccctagtgaaggagcag
tgggtactgactgcccggcaatgcatctggtcatgccacgaacctctcacaggatacgag
gtatggttgggtacaattaaccagaacccacagcctggagaggcaaacctgcagagggtc
ccagtggccaaggcagtgtgcggccctgcaggctcccagcttgttctgctcaagctggag
agacctgtgatcctgaaccatcacgtggccctgatttgcctgcctcctgaacagtatgtg
gtacctccagggaccaagtgtgagatcgcaggctggggtgaatccatcggtacaagcaat
aacacagtccttcatgtggcctcgatgaatgtcatctccaaccaggaatgtaacacgaag
taccgaggacacatacaagagagtgagatatgcacccagggactggtggtccctgtgggg
gcttgtgagggtgactacgggggcccacttgcctgctatacccatgactgctgggtccta
cagggacttatcatcccgaacagagtgtgtgcacggccccgctggccagctatcttcaca
cgggtgtctgtgttcgtggactggattaacaaggtcatgcagctggagtag

DBGET integrated database retrieval system