KEGG   Mus musculus (mouse): 15239
Entry
15239             CDS       T01002                                 

Gene name
Hgs, H, Hgr, Hrs, ZFYVE8, t, tn
Definition
(RefSeq) HGF-regulated tyrosine kinase substrate
  KO
K12182  hepatocyte growth factor-regulated tyrosine kinase substrate
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15239 (Hgs)
   04145 Phagosome
    15239 (Hgs)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    15239 (Hgs)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    15239 (Hgs)
SSDB
Motif
Pfam: VHS Hrs_helical FYVE FYVE_2 UIM
Other DBs
NCBI-GeneID: 15239
NCBI-ProteinID: NP_032270
MGI: 104681
Ensembl: ENSMUSG00000025793
Vega: OTTMUSG00000004240
UniProt: Q99LI8 Q3UMA3
Position
11 E2; 11 84.16 cM
AA seq 775 aa
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKASSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKTTYTAHPKAEPTPLASS
APPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ
PGEGHTAPNSMAEAPLPETDSQPITPCSGPFSEYQNGESEESHEQFLKALQNAVSTFVNR
MKSNHMRGRSITNDSAVLSLFQSINTMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARG
ALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEKE
RQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPATFSPAGSVEGS
PMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPTGAPGAQAAPQAQAGPTTSPAYSS
YQPTPTPGYQSVASQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTALPGQD
ASLPAQQPYIPGQQPLYQQMAPSTGPPQQQPPVAQPAPTQGPPAQGSEAQLISFD
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggggcgaggcagcggcaccttcgagcgtctcctagacaaagccaccagccagcttctg
ttggagacagactgggagtccattctacagatctgcgacctgatccgtcagggggacaca
caagcaaaatatgctgtaaactccatcaagaagaaggttaatgataagaacccacacgtg
gctttgtatgctctggaggtgatggagtctgtggtaaagaactgtggccagacagtccat
gatgaagtggccaacaaacagaccatggaagaactgaaggagctgctgaagaggcaagtg
gaagttaatgttcggaacaagatcttgtacctgatccaggcctgggcacatgccttccgg
aacgaacccaagtacaaggtggtccaggacacataccagatcatgaaggtagaaggacat
gtcttccctgaatttaaggaaagtgatgccatgttcgctgctgaaagagcccctgactgg
gtggatgctgaggaatgccatcggtgcagagtacagtttggggtggtgacccgcaagcat
cactgccgagcatgtgggcagatcttctgtggcaagtgctcctccaagtactccaccatc
cccaagttcggcattgagaaggaggtgcgcgtgtgtgagccctgctatgagcagctgaac
aagaaggcagaagggaaggcttcctctaccactgagctgcccccagagtacctgaccagc
cccctgtcacagcagtctcagctgcccccaaagcgggatgagacagccctgcaggaagag
gaggagctacagctggctctggccctatcacagtcagaggctgaggagaaagagaggatg
agacagaaaacaacatatacagcacatccaaaggcagagcccacgcccttggcttcctct
gcgcccccagctggcagcctgtattcctcgcctgtgaactcatcagcacctctggctgag
gacatcgaccctgagcttgcaagatacctcaaccggaactactgggagaagaaacaggag
gaagcacggaagagccccacaccatctgcacctgtgcccctgacagagcctgctgcccag
cctggagaaggacatacagcccccaacagcatggcagaggctcctcttccagagacagac
tctcagcccataactccctgcagcggcccctttagtgagtaccagaatggggagtcggag
gagagccatgagcagttcctcaaggccctgcagaatgccgtgagcacttttgtcaaccgc
atgaagagcaaccacatgcggggacgcagcatcaccaacgactcggctgtgctgtcactc
ttccagtccatcaacaccatgcacccgcagctgctcgagctgctcaaccagctggatgag
cgcaggctgtactacgagggccttcaggacaagctggcacagatacgtgacgcccgaggg
gctctgagcgccctgcgtgaagaacacagggagaagctgcgccgggcagctgaggaggct
gagcgtcaacgccagatccagctggcacagaaactggagatcatgagacagaagaagcag
gagtacctggaggtgcagagacagctagctatccagcgcctgcaggaacaggagaaggaa
cggcagatgcgtctggagcaacagaagcagactgtccagatgcgcgcccagatgcctgcc
tttcccttgccttatgcccagctccaggctatgcccacggctgggggtgtactctaccag
ccctcaggcccaaccagcttccctgccaccttcagcccagcaggctcagtagagggctct
ccgatgcatggtgtgtatatgagccagccagccccagccactggcccctaccccagcatg
cctggcacaacagcagatcccagcatggtcagcgcctacatgtacccaacaggtgcccct
ggggcacaggcagcccctcaggcccaggccgggcccaccaccagtcctgcctactcctcc
taccagcccacaccaaccccaggctaccagagcgtggcttctcaggccccacagagcctc
ccagccatctcacagcctccacagaccagcaacataggctacatggggagccagccaatg
tccatgggctaccagccgtacaatatgcagaatctcatgaccgcccttcccgggcaggat
gcgtctctgccagcccagcagccctacatcccagggcagcagcccctgtaccagcagatg
gcccccagcaccggccctccccagcagcaaccccctgtggcccagccagcgcctacacag
ggaccgccagcacagggcagtgaggcccagctcatctcctttgactga

DBGET integrated database retrieval system