KEGG   Mus musculus (mouse): 15251
Entry
15251             CDS       T01002                                 

Gene name
Hif1a, AA959795, HIF-1-alpha, HIF1-alpha, HIF1alpha, MOP1, bHLHe78
Definition
(RefSeq) hypoxia inducible factor 1, alpha subunit
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04659  Th17 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    15251 (Hif1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    15251 (Hif1a)
   04137 Mitophagy - animal
    15251 (Hif1a)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    15251 (Hif1a)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    15251 (Hif1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15251 (Hif1a)
   05205 Proteoglycans in cancer
    15251 (Hif1a)
   05230 Central carbon metabolism in cancer
    15251 (Hif1a)
   05231 Choline metabolism in cancer
    15251 (Hif1a)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    15251 (Hif1a)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    15251 (Hif1a)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    15251 (Hif1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15251 (Hif1a)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    15251 (Hif1a)
SSDB
Motif
Pfam: PAS_3 HIF-1a_CTAD PAS_11 PAS HIF-1 PAS_9 PAS_4 HLH
Other DBs
NCBI-GeneID: 15251
NCBI-ProteinID: NP_034561
MGI: 106918
Ensembl: ENSMUSG00000021109
Vega: OTTMUSG00000019740
UniProt: Q61221 Q3UCW2
Structure
PDB: 
4ZPR

Position
12 C3; 12 31.99 cM
AA seq 836 aa
MEGAGGENEKKKMSSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGGLDSEDEMKAQMDCFYLKALDGFVMVLTDDGDMVYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVRKGKELNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTESV
LKPVESSDMKMTQLFTKVESEDTSCLFDKLKKEPDALTLLAPAAGDTIISLDFGSDDTET
EDQQLEDVPLYNDVMFPSSNEKLNINLAMSPLPSSETPKPLRSSADPALNQEVALKLESS
PESLGLSFTMPQIQDQPASPSDGSTRQSSPERLLQENVNTPNFSQPNSPSEYCFDVDSDM
VNVFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNS
PSPPSMSTVTGFQQTQLQKPTITATATTTATTDESKTETKDNKEDIKILIASPSSTQVPQ
ETTTAKASAYSGTHSRTASPDRAGKRVIEQTDKAHPRSLNLSATLNQRNTVPEEELNPKT
IASQNAQRKRKMEHDGSLFQAAGIGTLLQQPGDCAPTMSLSWKRVKGFISSEQNGTEQKT
IILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggagggcgccggcggcgagaacgagaagaaaaagatgagttctgaacgtcgaaaagaa
aagtctagagatgcagcaagatctcggcgaagcaaagagtctgaagttttttatgagctt
gctcatcagttgccacttccccacaatgtgagctcacatcttgataaagcttctgttatg
aggctcaccatcagttatttacgtgtgagaaaacttctggatgccggtggtctagacagt
gaagatgagatgaaggcacagatggactgtttttatctgaaagccctagatggctttgtg
atggtgctaacagatgacggcgacatggtttacatttctgataacgtgaacaaatacatg
gggttaactcagtttgaactaactggacacagtgtgtttgattttactcatccatgtgac
catgaggaaatgagagaaatgcttacacacagaaatggcccagtgagaaaagggaaagaa
ctaaacacacagcggagcttttttctcagaatgaagtgcaccctaacaagccgggggagg
acgatgaacatcaagtcagcaacgtggaaggtgcttcactgcacgggccatattcatgtc
tatgataccaacagtaaccaacctcagtgtgggtacaagaaaccacccatgacgtgcttg
gtgctgatttgtgaacccattcctcatccgtcaaatattgaaattcctttagatagcaag
acatttctcagtcgacacagcctcgatatgaaattttcttactgtgatgaaagaattact
gagttgatgggttatgagccggaagaacttttgggccgctcaatttatgaatattatcat
gctttggattctgatcatctgaccaaaactcaccatgatatgtttactaaaggacaagtc
accacaggacagtacaggatgcttgccaaaagaggtggatatgtctgggttgaaactcaa
gcaactgtcatatataatacgaagaactcccagccacagtgcattgtgtgtgtgaattat
gttgtaagtggtattattcagcacgacttgattttctcccttcaacaaacagaatctgtg
ctcaaaccagttgaatcttcagatatgaagatgactcagctgttcaccaaagttgaatca
gaggatacaagctgcctttttgataagcttaagaaggagcctgatgctctcactctgctg
gctccagctgccggcgacaccatcatctctctggattttggcagcgatgacacagaaact
gaagatcaacaacttgaagatgttccattatataatgatgtaatgtttccctcttctaat
gaaaaattaaatataaacctggcaatgtctcctttaccttcatcggaaactccaaagcca
cttcgaagtagtgctgatcctgcactgaatcaagaggttgcattaaaattagaatcaagt
ccagagtcactgggactttcttttaccatgccccagattcaagatcagccagcaagtcct
tctgatggaagcactagacaaagttcacctgagagacttcttcaggaaaacgtaaacact
cctaacttttcccagcctaacagtcccagtgaatattgctttgatgtggatagcgatatg
gtcaatgtattcaagttggaactggtggaaaaactgtttgctgaagacacagaggcaaag
aatccattttcaactcaggacactgatttagatttggagatgctggctccctatatccca
atggatgatgatttccagttacgttcctttgatcagttgtcaccattagagagcaattct
ccaagccctccaagtatgagcacagttactgggttccagcagacccagttacagaaacct
accatcactgccactgccaccacaactgccaccactgatgaatcaaaaacagagacgaag
gacaataaagaagatattaaaatactgattgcatctccatcttctacccaagtacctcaa
gaaacgaccactgctaaggcatcagcatacagtggcactcacagtcggacagcctcacca
gacagagcaggaaagagagtcatagaacagacagacaaagctcatccaaggagccttaac
ctgtctgccactttgaatcaaagaaatactgttcctgaggaagaattaaacccaaagaca
atagcttcgcagaatgctcagaggaagcgaaaaatggaacatgatggctccctttttcaa
gcagcaggaattggaacattattgcagcaaccaggtgactgtgcacctactatgtcactt
tcctggaaacgagtgaaaggattcatatctagtgaacagaatggaacggagcaaaagact
attattttaataccctccgatttagcatgcagactgctggggcagtcaatggatgagagt
ggattaccacagctgaccagttacgattgtgaagttaatgctcccatacaaggcagcaga
aacctactgcagggtgaagaattactcagagctttggatcaagttaactga

DBGET integrated database retrieval system