KEGG   Mus musculus (mouse): 15257Help
Entry
15257             CDS       T01002                                 

Gene name
Hipk1, 1110062K04Rik, Myak
Definition
(RefSeq) homeodomain interacting protein kinase 1
  KO
K08826  homeodomain interacting protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    15257 (Hipk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    15257 (Hipk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     15257 (Hipk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   15257 (Hipk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Pkinase_fungal APH Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 15257
NCBI-ProteinID: NP_001288233
MGI: 1314873
Ensembl: ENSMUSG00000008730
Vega: OTTMUSG00000024242
UniProt: O88904
Position
3; 3 F2.2
AA seq 1210 aa AA seqDB search
MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSH
QVANFNLPAYDQGLLLPAPAVEHIVVTAADSSGSAATATFQSSQTLTHRSNVSLLEPYQK
CGLKRKSEEVESNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQH
EILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSR
LSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVA
TALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRA
PEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGT
KTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTD
MLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSHVKSCFQNME
ICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQASVLASSSTAAAATL
SLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTFIVCPPAFQ
TGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLTQGSCTPLMVATLHPQVATIT
PQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSAWQQLPGVALHNSVQPAAVI
PEAMGSSQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSS
LPSKKNKQSAPVSSKSSLEVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPS
PPVSVITIRSDTDEEEDNKYKPNSSSLKARSNVISYVTVNDSPDSDSSLSSPHPTDTLSA
LRGNSGTLLEGPGRPAADGIGTRTIIVPPLKTQLGDCTVATQASGLLSSKTKPVASVSGQ
SSGCCITPTGYRAQRGGASAVQPLNLSQNQQSSSASTSQERSSNPAPRRQQAFVAPLSQA
PYAFQHGSPLHSTGHPHLAPAPAHLPSQPHLYTYAAPTSAAALGSTSSIAHLFSPQGSSR
HAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRGSTIYTGYPLS
PTKISQYSYL
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atggcctcacagctgcaggtgttttcgcccccatcagtgtcgtcgagtgccttctgcagt
gcaaagaaactgaaaatagagccctctggctgggatgtttcaggacagagcagcaacgac
aaatactatacccacagcaaaaccctcccagctacacaagggcaagccagctcctctcac
caggtagcaaatttcaatcttcctgcttacgaccagggcctccttctcccagctcctgcc
gtggagcatattgtggtaacagctgctgatagctcaggcagcgccgctacagcaaccttc
caaagcagccagaccctgactcacaggagcaacgtttctttgcttgagccatatcaaaaa
tgtggattgaagagaaagagtgaggaagtggagagcaacggtagcgtgcagatcatagaa
gaacacccccctctcatgctgcagaacagaaccgtggtgggtgctgctgccacgaccacc
actgtgaccaccaagagtagcagttccagcggagaaggggattaccagctggtccagcat
gagatcctttgctctatgaccaacagctatgaagtcctggagttcctaggccgggggaca
tttggacaggtggcaaagtgctggaagcggagcaccaaggaaattgtggccattaagatc
ttgaagaaccacccctcctatgccagacaaggacagattgaagtgagcatcctttcccgc
ctaagcagtgaaaatgctgatgagtataactttgtccgttcttatgagtgttttcagcac
aagaatcatacctgccttgtgtttgagatgttggagcagaacttgtacgattttctaaag
cagaacaagtttagcccactgccactcaagtacataagaccaatcttgcagcaggtggcc
acagccctgatgaagctgaagagtcttggtctgattcatgctgaccttaaacctgaaaac
ataatgctagtcgatccagttcgccaaccctaccgagtgaaggtcattgactttggttct
gctagtcatgtttccaaagccgtgtgttcaacctacctgcaatcacgctactacagagct
cctgaaattatccttggattaccattctgtgaagctattgacatgtggtcactgggctgt
gtaatagctgagctgttcctgggatggcctctttatcctggtgcttcagaatacgatcag
attcgctatatttcacaaacacaaggcctgccagctgagtatcttctcagtgccggaaca
aaaacaaccaggttttttaacagagatcctaatttggggtacccactgtggaggcttaag
acacctgaagaacatgaattggaaactggaataaagtcaaaagaagctcggaagtacatt
tttaactgtttagatgacatggctcaggtaaatatgtctacagacttagaggggacagat
atgttagcagagaaagcagatcggagagagtatattgatcttctaaagaaaatgctgacg
attgatgcagataagagaatcacgcctctgaagactcttaaccaccaatttgtgacgatg
agtcacctcctggactttcctcacagcagccacgttaagtcctgtttccagaacatggag
atctgcaagcggagggttcacatgtatgacacagtgagtcagatcaagagtcccttcact
acacatgtcgctccaaatacaagcacaaatctaaccatgagcttcagcaaccagctcaac
acagtgcacaatcaggccagtgttctagcttccagctctactgcagcagcagctaccctt
tctctggctaattcagatgtctcgctgctaaactaccaatcggctttgtacccatcgtcg
gcagcgccagttcctggagttgcccagcagggtgtttccttacaacctggaaccacccag
atctgcactcagacagatccattccagcaaacatttatagtatgcccacctgcttttcag
actggactacaagcaacaacaaagcattctggattccctgtgaggatggataatgctgtg
ccaattgtaccccaggcgcctgctgctcagccgctgcagatccagtcaggagtactcaca
cagggaagctgtacaccactaatggtagcaactctccaccctcaagtagccaccatcacg
ccgcagtatgcggtgccctttaccctgagctgcgcagcaggccggccggcgctggttgaa
cagactgctgctgtactgcaagcctggcctggaggaacccaacaaattctcctgccttca
gcctggcagcagctgcccggggtagctctgcacaactctgtccagcctgctgcagtgatt
ccagaggccatggggagcagccaacagctagctgactggaggaatgcccactctcatggc
aaccagtacagcactattatgcagcagccatctttgctgaccaaccatgtgaccttggcc
actgctcagcctctgaatgttggtgttgcccatgttgtcagacaacaacagtctagttcc
ctcccttcaaagaagaataagcagtctgctccagtttcatccaaatcctctctggaagtc
ctgccttctcaagtttattctctggttgggagtagtcctcttcgtaccacatcttcttat
aattccctagttcctgtccaagaccagcatcagccaatcatcattccagatacccccagc
cctcctgtgagtgtcatcactatccgtagtgacactgatgaagaagaggacaacaaatac
aagcccaatagctcgagcctgaaggcgaggtctaatgtcatcagttatgtcactgtcaat
gattctccagactctgactcctccctgagcagcccacatcccacagacactctgagtgct
ctgcggggcaacagtgggacccttctggagggacctggcagacctgcagcagatggcatt
ggcacccgtactatcattgtgcctcctttgaaaacacagcttggcgactgcactgtagca
acacaggcctcaggtctccttagcagtaagaccaagccagtggcctcagtgagtgggcag
tcatctggatgctgtatcactcccacggggtaccgggctcagcgagggggagccagcgcg
gtgcagccactcaaccttagccagaaccagcagtcatcgtcagcttcaacctcgcaggaa
agaagcagcaaccctgctccccgcagacagcaggcatttgtggccccgctctcccaagcc
ccctacgccttccagcatggcagcccactgcactcgacggggcacccacacttggcccca
gcccctgctcacctgccaagccagcctcacctgtatacgtacgctgcccccacttctgct
gctgcattgggctccaccagttccattgctcatctgttctccccccagggttcctcaagg
catgctgcagcttataccacacaccctagcactctggtgcatcaggttcctgtcagtgtc
gggcccagcctcctcacttctgccagtgtggcccctgctcagtaccaacaccagtttgcc
actcagtcctacatcgggtcttcccgaggctcaacaatttacactggatacccgctgagt
cctaccaagatcagtcagtattcttacttgtag

DBGET integrated database retrieval system