KEGG   Mus musculus (mouse): 15260
Entry
15260             CDS       T01002                                 

Gene name
Hira, AA138857, D16Ertd95e, Gm15797, N28177, Tuple1
Definition
(RefSeq) histone cell cycle regulator
  KO
K11293  protein HIRA/HIR1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15260 (Hira)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     15260 (Hira)
SSDB
Motif
Pfam: Hira WD40 ANAPC4_WD40 HIRA_B Mcl1_mid WD40_like
Other DBs
NCBI-GeneID: 15260
NCBI-ProteinID: NP_034565
MGI: 99430
Ensembl: ENSMUSG00000022702
Vega: OTTMUSG00000026265
UniProt: Q61666
Position
16 A3; 16 11.69 cM
AA seq 1015 aa
MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIP
KMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQ
WRCVSILRSHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGL
TWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSA
HAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSTKPSCPYCCC
AVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQD
ELGDPLSEEEKSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKNATT
RETSSASSVTGVVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFN
SIPLSSSLAGTMLSSPSGQQLLPLDSSTPSFGASKPCTEPVAATSARPTGESVSKDSMNA
TSTPAASSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPSLTSVIPTAVERLKEQNLVKE
LRSRELESSSDSDEKVHLAKPSSLSKRKLELEVETVEKKKKGRPRKDSRLLPMSLSVQSP
AALSTEKEAMCLSAPALALKLPIPGPQRAFTLQVSSDPSMYIEVENEVTTVGGIRLSRLK
CNREGKEWETVLSSRVLTAAGSCDVVCVACEKRMLSVFSTCGRRLLPPILLPSPISTLHC
TGPYVMALTAAATLSVWDVHRQVVVVKEESLHSILSGSDMTVSQILLTQHGIPVMNLSDG
KAYCFNPSLSTWNLVSDKQDSLAQCADFRNSLPSQDAMLCSGPLAIIQGRTSNSGRQAAR
LFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLLYARYLVNEGFEYRLREICKDL
LGPVHCSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK
NT seq 3048 nt   +upstreamnt  +downstreamnt
atgaagctcttgaagccaacctgggtcaaccacaatgggaagccaattttttcagttgat
attcaccctgatgggaccaagtttgcaactggaggacaagggcaggattctgggaaggtt
gtgatctggaatatgtctccagtcctccaggaggatgacgagaaggatgaaaatattccc
aagatgctttgccagatggacaatcacttagcatgtgtgaactgtgtgcggtggtcaaac
agtgggatgtatttagcttctgggggagatgacaaactgattatggtgtggaagcgggct
acgtacattgggcccagcactgtgtttggttccagtggtaagcttgccaatgtggagcaa
tggcggtgtgtctccatcctccggagtcactcaggcgatgtgatggatgtagcatggtct
ccccacgacgcctggctggcctcatgcagcgtggataacactgttgtcatttggaatgcc
gtgaagttcccagaaattcttgcaactctgagaggtcattctggcttagtaaaaggtttg
acttgggatcccgttggtaaatatattgcctctcaagctgatgatcgaagtttgaaggta
tggaggacgctggactggcagctagagactagcatcaccaagccttttgatgagtgtgga
ggaacgacgcatgttctccggcttagttggtcacctgatggccattacctggtatctgcc
catgccatgaataattctggccccactgctcagatcatcgaaagagagggctggaagacc
aacatggactttgtgggtcaccggaaagctgtgactgttgtgaaattcaacccaaaaatc
ttcaagaagaagcagaagaatgggagctctacaaagcccagctgcccatactgctgctgt
gctgttggcagcaaggaccgctcactctctgtctggctcacatgtttgaaacggcctctg
gttgtcatccatgaactgtttgacaagtccatcatggatatttcctggactctgaatggg
ttgggtatcctggtgtgctccatggacggctctgtggcgttccttgatttctctcaggat
gaactcggagaccccctgagtgaggaggaaaagagccgaattcaccagtctacctatggc
aagagcctggcaataatgactgaggcccagctttccacagctgttattgagaaccctgag
atgctcaagtaccagcggagacagcaacagcagcagctggatcagaagaatgccactact
agggagacaagctcagcatcctcagtcacgggtgtggtcaatggggaaagtctagaagat
atcagaaagaatcttttgaagaaacaagtggaaactcggacagcagatggtcggaggaga
atcacgcctctttgcatagcacagctggacactggggacttctccacggcattcttcaac
agcatcccactctccagctccctagcaggcaccatgctctcctctcctagtggtcagcag
ctactaccactggactccagtaccccctccttcggcgcctcaaagccttgcacagaacca
gtggcagccaccagtgccaggcctacaggcgaatctgtcagtaaggacagtatgaatgct
acctctactcctgctgcatcgtcaccctctgtgttaacaaccccatccaagattgaaccc
atgaaagcatttgattcccggttcacagaacggtccaaagccacaccaggtgctccttcc
ttgaccagtgtgattccaacagctgttgaaaggttgaaagagcagaacctcgtcaaggag
ctgaggtcccgggaactggagagcagcagtgacagcgatgagaaggtccacctagccaag
ccctcttcactgtccaagcgcaaacttgagcttgaggtagagacggtggaaaagaagaag
aaaggtcgccctaggaaggattcacgtcttttacccatgtctctgtccgtccagtctcca
gctgccctgtctacagagaaggaggccatgtgtctgtctgcaccagcacttgcactgaag
ctgccaattccaggcccacagagagcgttcaccctccaggtgagctctgacccctccatg
tacattgaggtggagaatgaagtgaccaccgttggggggataaggctgagtcgcctgaag
tgcaaccgtgaagggaaggagtgggagacagtgctcagcagtcgcgtcctcactgctgcc
ggcagctgtgatgtggtatgtgttgcctgtgaaaagaggatgctgtcggtgttctctacc
tgtggtcgccgtctcctccctcccatcctccttccatctccaatctctactttgcactgc
acgggcccctacgtcatggcactcaccgctgcagccacactgtctgtctgggatgttcac
agacaggtggttgtggtgaaagaagaatctctacactccatcttgtcaggaagtgatatg
acggtgtcacagatcttgctaacacagcatggaatcccagtgatgaatttgtctgatggg
aaagcatactgctttaatccatccctctccacatggaacctggtttctgacaagcaagat
tcattggcccagtgtgcagacttcaggaacagcctgccgtcccaggatgccatgctttgt
tcaggaccgttagccataattcagggccgcacctccaactctggaaggcaagctgcccgg
ctcttctccgtgcctcatgtggtacagcaggagaccacactggcctacctagagaaccag
gttgctgcggcacttaccctgcagtcaagccacgagtatcgtcactggctcctcctttat
gctcggtaccttgtgaatgaagggtttgaataccgcctccgtgaaatatgcaaggacttg
ctgggtccagttcactgctccactggaagtcagtgggagtcaacagtagtgggtctgcgg
aaaagggagctgctgaaggaactgttgccagtcattgggcagaatcttcgattccagcgc
ctctttactgagtgccaggaacaactggacatcctgagagacaagtag

DBGET integrated database retrieval system