KEGG   Mus musculus (house mouse): 15284
Entry
15284             CDS       T01002                                 
Symbol
Hlx, Hlx1
Name
(RefSeq) H2.0-like homeobox
  KO
K09339  homeobox protein HLX1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15284 (Hlx)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    15284 (Hlx)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 15284
NCBI-ProteinID: NP_032276
MGI: 96109
Ensembl: ENSMUSG00000039377
Position
1:complement(184459340..184464690)
AA seq 476 aa
MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFALDPAAVKKPSFCIADILHAGVGEPGPA
AEGLVGASAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAFHQ
HLPQQSPTQQQQPQQQPPPPPRAVSLQPPTSGTRVVPHHSGSAPAPSSKDLKFGIDRILS
AEFDPKVKEGNTLRDLTSLLTGGRPAGVHLAGLQPSAGQFFASLDPISEASAILSPLSSN
PRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTK
PDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGVPAEGEREE
RSPSRSEGEAESESSDSESLDMAPSDTERTEGTERSLHQTTVIKASAAGALITASSSTSG
SSFSFSSTSSLGSGNTHVGSASSLGGNCSELPSAHQPSVTSSPQSPEIAQAPLAGL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgttcgcagccggcctggctcccttctatgcttccaactttagtctctggtcagccgcc
tactgctcctcggcgggcccgggcggctgctccttcgccctggacccagccgctgtcaag
aaaccctctttctgcatcgcggacatcctgcacgccggcgtcggggagccggggcccgct
gcagagggactggtgggggcctcggcagccctcaccgcacacttgggctccgtgcacccg
cacgcctccttccaagctgccgccagatccccgctccgtcccaccccggtggtggcgccc
tcagaagtcccggctggcttccctcagcggctgtctccgctctctgccgccttccaccag
catctcccgcagcaatcaccaacgcagcaacagcaaccgcagcagcagcccccgcctcca
ccccgggcggtctccctgcagccaccgacttcggggacgcgggtggtcccccaccatagc
ggctccgcccctgccccctccagcaaagacctcaaatttggtatcgatcgaattttgtct
gcggaatttgacccaaaagttaaggaaggcaacactctgagagatctcacatcgctgcta
accggtgggcggcctgcaggggtgcatctagctggcctgcagccttcagcgggacagttc
ttcgcatctctagatcccattagcgaggcgtctgccatcctcagccccttaagctccaac
ccaagaaattctgttcagcatcaattccaagacacatttccaggtccctatgctgtgctc
actaaggacaccatgccacagacatacaagcggaagcgctcgtggtcccgtgctgtcttt
tccaacctgcaaagaaaaggcctggagaagaggtttgagatccagaagtacgtgaccaag
ccagaccgaaagcagctggcggccatgctgggcctcacggatgcacaggtgaaggtgtgg
ttccagaaccggaggatgaagtggcggcactctaaggaggcgcaggcgcagaaggacaag
gacaaggaagcgggcgagaagccttccggcggagtccccgccgagggtgaacgggaggag
aggagccccagccgttctgagggcgaagccgagagcgagagcagtgactcggagtccctg
gacatggcccccagcgacacggaacggactgagggaacggagaggtccctgcatcaaacc
acggtcatcaaggcctcagccgcgggtgccctcatcactgccagcagcagcacgagtggt
agcagcttcagtttcagcagcaccagcagcctgggtagcggcaacacccacgtggggagc
gccagcagccttggcggcaactgctcggagctgccttcggctcaccagccctcagtcacc
agcagtcctcaaagcccggagatcgcccaggccccgcttgcaggtttatag

DBGET integrated database retrieval system