KEGG   Mus musculus (mouse): 15285
Entry
15285             CDS       T01002                                 

Gene name
Mnx1, HB9, Hlxb, Hlxb9, MN, MNR2
Definition
(RefSeq) motor neuron and pancreas homeobox 1
  KO
K08025  homeobox protein HB9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    15285 (Mnx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15285 (Mnx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Eve
    15285 (Mnx1)
SSDB
Motif
Pfam: Homeodomain QLQ
Other DBs
NCBI-GeneID: 15285
NCBI-ProteinID: NP_064328
MGI: 109160
Ensembl: ENSMUSG00000001566
Vega: OTTMUSG00000037528
UniProt: A2RSX2
Position
5; 5 B1
AA seq 404 aa
MEKSKNFRIDALLAVDPPRAASTQSAPLALVTSLATTVSGPGRGGSGGGGTSSGASRSCS
PASSEATAAPGDRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGAAGGPGTPHHHAHPG
AAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPVYSYSAAAAAAALAGQHP
ALSYSYPQVQGAHPAHPADPIKLGASTFQLDQWLRASTAGMILPKMPDFSSQAQSNLLGK
CRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK
KAKEQAAQEAEKQKGGGGGTGKGGSEEKTEEELMGPPVSGDKASGRRLRDLRDSDPDEDE
DDEEEDNFPYSNGAGAHAASSDCSSEDDSPPPRLGGPGHQPLPQ
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggaaaaatccaaaaatttccgcatcgacgccctgctggccgtggatcccccgcgagcc
gcctccacgcagagcgcgcctctggccttggtcacttccctcgcgactacagtatctggt
cccggccgcggcggcagcggcggcggggggaccagtagcggggcgagccgtagctgcagt
cccgcatcctcggaggccactgcagcgcccggtgaccggctgagagctgagagcccgtcg
cccccacgcttgctggctgcacactgcgcgctgctgcccaagcccggattcctgggcgcc
ggaggaggcggcggcgcggcgggtgggccgggcactccccaccaccacgcgcaccctggt
gcagcagccgccgcggctgccgctgccgctgccgcggctgccggtggcctggcactgggg
ctgcacccggggggcgcacagggcggcgcgggcctccctgcacaggcggctctctatgga
cacccggtctacagttattcggcagcagctgcagcggccgcgctagctggccagcacccg
gcgctttcctactcataccctcaggtgcagggcgcgcaccctgcgcaccctgccgacccc
atcaagctgggtgccagcaccttccaactggaccagtggctgcgcgcgtctactgcgggc
atgatcctgcccaagatgccggacttcagctcccaggcgcagtcgaacctcttggggaag
tgccgaaggcctcgcacggccttcaccagccagcagctgttggagctggaacaccagttc
aagctcaacaagtacctgtctcgacccaagcgttttgaggtggctacctcgctcatgctc
accgagactcaggtgaagatttggttccagaaccgccgaatgaaatggaaacgcagcaaa
aaggccaaagagcaggctgcgcaggaggcggagaagcagaagggcggcggcgggggcacc
ggcaaaggcggcagtgaggagaagacggaagaggagctgatggggcctccggtttcgggg
gacaaggcaagcggccgtcgcctgcgggacttgcgggacagtgaccctgatgaggacgag
gatgatgaagaagaggacaacttcccgtacagcaatggtgccggtgcccatgctgcctca
tccgactgctcatctgaggacgactcgcctcctccaagactaggcgggcctggacaccaa
cctctgccccagtag

DBGET integrated database retrieval system