KEGG   Mus musculus (mouse): 15289
Entry
15289             CDS       T01002                                 

Gene name
Hmgb1, HMG-1, Hmg1, SBP, SBP-1, amph, p3, p30
Definition
(RefSeq) high mobility group box 1
  KO
K10802  high mobility group protein B1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04140  Autophagy - animal
mmu04217  Necroptosis
mmu04613  Neutrophil extracellular trap formation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    15289 (Hmgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    15289 (Hmgb1)
  09143 Cell growth and death
   04217 Necroptosis
    15289 (Hmgb1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    15289 (Hmgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15289 (Hmgb1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    15289 (Hmgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15289 (Hmgb1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    15289 (Hmgb1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     15289 (Hmgb1)
   MMR (mismatch excision repair)
    Other MMR factors
     15289 (Hmgb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   15289 (Hmgb1)
SSDB
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5 NOA36 Nop14
Other DBs
NCBI-GeneID: 15289
NCBI-ProteinID: NP_001300823
MGI: 96113
Ensembl: ENSMUSG00000066551
Vega: OTTMUSG00000016672
UniProt: P63158 Q58EV5
Structure
PDB: 
5ZE0 5ZDZ 5ZE1 5ZE2

Position
5 G3; 5 89.18 cM
AA seq 215 aa
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
NT seq 648 nt   +upstreamnt  +downstreamnt
atgggcaaaggagatcctaaaaagccgagaggcaaaatgtcctcatatgcattctttgtg
caaacttgccgggaggagcacaagaagaagcacccggatgcttctgtcaacttctcagag
ttctccaagaagtgctcagagaggtggaagaccatgtctgctaaagaaaaggggaaattt
gaagatatggcaaaggctgacaaggctcgttatgaaagagaaatgaaaacctacatcccc
cccaaaggggagaccaaaaagaagttcaaggaccccaatgcacccaagaggcctccttcg
gccttcttcttgttctgttctgagtaccgccccaaaatcaaaggcgagcatcctggctta
tccattggtgatgttgcaaagaaactaggagagatgtggaacaacactgcagcagatgac
aagcagccctatgagaagaaagctgccaagctgaaggagaagtatgagaaggatattgct
gcctacagagctaaaggaaaacctgatgcagcgaaaaagggggtggtcaaggctgaaaag
agcaagaaaaagaaggaagaggaagatgatgaggaggatgaagaggatgaggaagaggag
gaagaagaggaagacgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system