KEGG   Mus musculus (mouse): 15289Help
Entry
15289             CDS       T01002                                 

Gene name
Hmgb1, HMG-1, Hmg1, SBP-1, p30
Definition
(RefSeq) high mobility group box 1
  KO
K10802  high mobility group protein B1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03410  Base excision repair
mmu04140  Autophagy - animal
mmu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    15289 (Hmgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    15289 (Hmgb1)
  09143 Cell growth and death
   04217 Necroptosis
    15289 (Hmgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15289 (Hmgb1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    15289 (Hmgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15289 (Hmgb1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    15289 (Hmgb1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     15289 (Hmgb1)
   MMR (mismatch excision repair)
    Other MMR factors
     15289 (Hmgb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   15289 (Hmgb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5 NOA36 Nop14
Motif
Other DBs
NCBI-GeneID: 15289
NCBI-ProteinID: NP_001300823
MGI: 96113
Ensembl: ENSMUSG00000066551
Vega: OTTMUSG00000016672
UniProt: P63158 Q58EV5
Structure
PDB: 

Position
5 G3; 5 89.18 cM
AA seq 215 aa AA seqDB search
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggagatcctaaaaagccgagaggcaaaatgtcctcatatgcattctttgtg
caaacttgccgggaggagcacaagaagaagcacccggatgcttctgtcaacttctcagag
ttctccaagaagtgctcagagaggtggaagaccatgtctgctaaagaaaaggggaaattt
gaagatatggcaaaggctgacaaggctcgttatgaaagagaaatgaaaacctacatcccc
cccaaaggggagaccaaaaagaagttcaaggaccccaatgcacccaagaggcctccttcg
gccttcttcttgttctgttctgagtaccgccccaaaatcaaaggcgagcatcctggctta
tccattggtgatgttgcaaagaaactaggagagatgtggaacaacactgcagcagatgac
aagcagccctatgagaagaaagctgccaagctgaaggagaagtatgagaaggatattgct
gcctacagagctaaaggaaaacctgatgcagcgaaaaagggggtggtcaaggctgaaaag
agcaagaaaaagaaggaagaggaagatgatgaggaggatgaagaggatgaggaagaggag
gaagaagaggaagacgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system