KEGG   Mus musculus (mouse): 15356
Entry
15356             CDS       T01002                                 

Gene name
Hmgcl, AW476067, HL
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-Coenzyme A lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Module
mmu_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    15356 (Hmgcl)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    15356 (Hmgcl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    15356 (Hmgcl)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    15356 (Hmgcl)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     15356 (Hmgcl)
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 15356
NCBI-ProteinID: NP_032280
MGI: 96158
Ensembl: ENSMUSG00000028672
Vega: OTTMUSG00000009847
UniProt: P38060
Position
4 D3; 4 68.14 cM
AA seq 325 aa
MASVRKAFPRRLVGLTSLRAVSTSSMGTLPKQVKIVEVGPRDGLQNEKSIVPTPVKIRLI
DMLSEAGLPVIEATSFVSPKWVPQMADHSDVLKGIQKFPGINYPVLTPNMKGFEEAVAAG
AKEVSVFGAVSELFTRKNANCSIEESFQRFAGVMQAAQAASISVRGYVSCALGCPYEGKV
SPAKVAEVAKKLYSMGCYEISLGDTIGVGTPGLMKDMLTAVMHEVPVTALAVHCHDTYGQ
ALANTLVALQMGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLNGLGIHTGVNLQKLL
EAGDFICQALNRKTSSKVAQATCKL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgtcagtgaggaaggctttcccgcggaggctggtgggcttgacgtccctccgggct
gtgagcacctcctccatgggcactttgccaaagcaggtgaagatcgtggaagtcggtccc
cgagatgggctgcagaatgaaaagagtattgtacccaccccagtgaagatcaggctgatc
gacatgctttccgaagcagggctccccgtgatcgaggccaccagctttgtttctcccaag
tgggtgccacagatggctgaccactctgacgtcttgaagggcattcagaagtttcccggc
atcaactacccagtcctgactccaaacatgaaaggctttgaggaagcggtagctgcgggt
gccaaggaagtgagcgtcttcggtgctgtgtctgagctcttcacccggaagaacgcgaac
tgctctatagaggagagtttccagcgctttgctggagtcatgcaggcggcccaggccgcc
agcatctctgtgagagggtatgtctcctgtgccctcggatgcccctacgaggggaaggtc
tccccggctaaagttgctgaggttgccaagaagttgtactcgatgggctgctatgagatc
tcccttggggacaccatcggcgtaggtaccccaggactcatgaaagacatgctgactgct
gtcatgcatgaagtgcctgtgacagcattggctgtccactgccatgatacctatggtcaa
gctctggccaacaccttggtggccctgcagatgggtgtgagtgttgtggactcctctgtg
gcaggacttggaggctgtccctatgcaaaaggggcatcagggaacttggctactgaggac
ctggtctacatgctgaatggcttagggattcacacgggtgtgaacctccagaaacttcta
gaagctggggacttcatctgtcaagcccttaacagaaaaactagttccaaagtggcacag
gccacctgcaagctctga

KEGG   Mus musculus (mouse): 208982
Entry
208982            CDS       T01002                                 

Gene name
Hmgcll1, BC037381
Definition
(RefSeq) 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Module
mmu_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    208982 (Hmgcll1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    208982 (Hmgcll1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    208982 (Hmgcll1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    208982 (Hmgcll1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     208982 (Hmgcll1)
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 208982
NCBI-ProteinID: NP_776092
MGI: 2446108
Ensembl: ENSMUSG00000007908
Vega: OTTMUSG00000027403
UniProt: Q8JZS7
Position
9; 9 D
AA seq 343 aa
MGNLPSAAKHCLNYQQLLREHLWSGDSVAGALDAAQEASQLPGLPEYVKIVEVGPRDGLQ
NEKVIVPTDIKIELINQLSQTGLSVIEVTSFVSSRWVPQMADHAEVMRGIRQYPGVRYPV
LTPNLQGFQHAVAAGATEIAVFGAASESFSKKNINCSIEESMGRFQEVISSARHMDIPVR
GYVSCALGCPYEGSITPQKVTEVSKRLYGMGCYEISLGDTIGVGTPGSMKMMLESVMKEI
PPGALAVHCHDTYGQALANILTALQMGINVVDSAVSGLGGCPYAKGASGNVATEDLIYML
NGMGLNTGVDLYKVMEAGEFICKAVNKTTNSKVAQASFNARLE
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggggaatctaccatctgctgcgaagcactgcctcaactaccagcagcttctccgcgaa
catctctggagcggagactcagtggcaggggcgctggatgcggcgcaggaagcatctcag
ttacctggactccctgaatatgtgaaaatagtcgaagttggaccaagggatggattgcag
aatgaaaaggttatagttcccacagacataaaaattgaactcatcaatcaactttcccaa
actggcttgtctgtaatagaagtaaccagctttgtgtcttccagatgggtaccacagatg
gctgaccatgctgaagtgatgcgaggcattcgtcagtatccaggagttcgctatcctgtc
cttacacctaatcttcagggttttcagcatgctgttgctgctggagccacggagatagca
gtttttggtgctgcttcagaatcttttagcaagaagaatattaactgctccattgaagaa
agtatgggaaggtttcaggaggtcatcagctctgcaagacacatggacatcccagtgcga
gggtacgtgtcctgcgccctgggctgcccatatgaaggaagcatcacaccacagaaagtc
acagaagtttcaaagagattgtatggtatgggctgctatgaaatatctttgggcgacacg
attggagttggtactccaggcagcatgaagatgatgttggaaagtgtcatgaaagaaatc
cctccaggggctcttgctgttcattgccatgacacatatggacaagccctcgcaaatatc
ctaacagctcttcagatggggattaatgtggtggattctgctgtatccggattaggtggc
tgcccttatgcaaaaggtgcttctgggaatgtagccactgaggatttgatatatatgctc
aatggcatggggctcaatacaggtgtggatctctacaaggtgatggaagctggtgagttt
atttgcaaggcagtgaacaaaactacaaactctaaagtcgcacaagcctccttcaacgct
cgccttgaatga

DBGET integrated database retrieval system