KEGG   Mus musculus (mouse): 15357
Entry
15357             CDS       T01002                                 

Symbol
Hmgcr, HMG-CoAR, Red
Name
(RefSeq) 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
  KO
K00021  hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00900  Terpenoid backbone biosynthesis
mmu01100  Metabolic pathways
mmu04152  AMPK signaling pathway
mmu04976  Bile secretion
Module
mmu_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    15357 (Hmgcr)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    15357 (Hmgcr)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    15357 (Hmgcr)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     15357 (Hmgcr)
SSDB
Motif
Pfam: HMG-CoA_red Sterol-sensing Patched
Other DBs
NCBI-GeneID: 15357
NCBI-ProteinID: NP_032281
MGI: 96159
Ensembl: ENSMUSG00000021670
Vega: OTTMUSG00000035511
UniProt: Q01237 Q8BV96
Position
13 D1; 13 50.65 cM
AA seq 887 aa
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTAEQAKVSLGLDEDVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLAFLLAVKYIFFEQAETESTLSLKNPITSPVVT
SKKAQDNCCRREPLLVRRNQKLSSVEEDPGANQERKVEVIKPLVVEAETTSRATFVLGAS
VASPPSALGTQEPGIELPIEPRPNEECLQILENAEKGAKFLSDAEIIQLVNAKHIPAYKL
ETLMETHERGVSIRRQLLSTKLAEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVA
GPLCLDGKEYQVPMATTEGCLVASTNRGCRAISLGGGASSRVLADGMTRGPVVRLPRACD
SAEVKTWLETPEGFAVIKEAFDSTSRFARLQKLHVTMAGRNLYIRFQSRTGDAMGMNMIS
KGTEKALLKLQEFFPDMQILAVSGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVL
KTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLM
EASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARI
VCGTVMAGELSLMAALAAGHLVRSHMVHNRSKINLQDLQGTCTKKAA
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgttgtcaagacttttccggatgcatggcctcttcgtggcctcccacccctgggaagtt
attgtgggaacagtgacacttacaatctgtatgatgtccatgaacatgttcaccggcaac
aacaagatctgtggctggaattatgagtgccctaaatttgaagaggacgtgctgagcagc
gacatcatcatcctgacgataacgcggtgcatcgccatcctgtacatttacttccagttc
cagaacctacggcagcttgggtccaagtacattctgggtattgctggcctcttcacaatt
ttctcaagctttgtcttcagtacagtcgtcattcatttcctcgacaaagaactgacaggc
ttaaatgaagctttgcccttttttctgctcttgattgacctttctagagcgagtgcatta
gcaaagtttgccctcagttcaaattcacaggatgaagtaagggaaaatatagctcgtgga
atggcaatcctgggccccacattcactcttgacgctcttgtggaatgccttgtgattgga
gttggcaccatgtcaggcgtccgccagctggagatcatgtgctgcttcggctgcatgtca
gtgttggccaactactttgtgttcatgacattcttcccggcctgtgtgtcgctggtccta
gagctttctcgtgaaagccgtgagggtcgtccaatttggcagctcagccattttgccaga
gttttagaagaagaagaaaataaaccaaaccccgtaacccaaagggtcaagatgattatg
tctttaggcttggtccttgttcacgctcatagtcgctggatagctgatccttctcctcag
aacagcacagcggagcaggctaaggtttccttgggtctggacgaagatgtgtccaagaga
attgaaccaagtgtttctctctggcagttttatctctccaagatgatcagcatggacatt
gagcaagtgattaccctgagtttagccttccttttggctgtcaagtatattttctttgaa
caagcagagacagaatcgacactgtcattaaaaaatcctatcacgtctcccgtcgtgacc
tcaaagaaagctcaagacaactgttgtagacgtgagcctctgcttgtgagaaggaaccag
aagctttcgtcagtagaggaggatccaggagcgaaccaagagagaaaagttgaggttata
aaaccattagtggtggaagcagagactacaagcagagctacgtttgtgcttggggcttct
gtagccagccctccatccgccctggggacacaggagcctggaattgaactccccatcgag
ccacgacctaatgaagaatgtctgcagatactggagaatgcagagaaaggtgcaaagttc
cttagtgatgcagagatcatccagttggtcaatgccaagcatatcccagcttacaaattg
gaaactctaatggaaactcatgaacgtggtgtgtctattcgccggcagctcctctccaca
aagcttgcagagccgtcctctctacagtacctgccttacagagattataattattccttg
gtgatgggagcttgctgtgagaatgtgatcggatatatgcccatccctgttggagtggca
gggcctctgtgcctggatgggaaggagtaccaggtgccgatggcaacgacggaaggctgt
cttgtggccagcactaacagaggctgcagagccataagccttggtggaggtgccagcagc
cgggtccttgcagatgggatgactcgaggcccagtggtgcgtcttccacgtgcttgtgac
tctgcagaagtaaagacctggcttgaaacacctgaagggtttgcagtgataaaggaggcc
tttgatagcaccagcagatttgctcgtctacagaaactccacgtgacgatggcaggacgc
aacctctatatccgtttccagtccaggacgggggacgccatgggcatgaacatgatctct
aagggtacggagaaagcactgctgaagcttcaggagttctttcctgacatgcagattctg
gcagtcagtgggaactattgcaccgacaagaagcctgctgccataaattggatcgaagga
cgaggaaagactgtggtttgtgaagccgtcattccagccaaggtggtgagagaggtgtta
aagacaactacggaagctatggttgacgtaaacattaacaagaatcttgtgggctcggcc
atggctgggagcataggcggctacaacgcccacgcagcaaacattgtcactgctatctac
atcgcatgtggccaggatgcagcacagaatgtggggagttcaaactgtattactttaatg
gaagccagtggtcccacaaatgaagacttatatatcagctgcaccatgccatcgatagag
ataggaaccgtgggtggtgggaccaaccttctacctcagcaagcctgcctgcagatgcta
ggtgttcaaggagcatgcaaagacaatcctggagaaaacgcacggcagcttgcccgaatt
gtatgtggcactgtgatggctggtgagctgtccttgatggcagccttggcagcaggacat
cttgtcagaagtcacatggttcacaacagatcaaagataaatttacaagatcttcaagga
acgtgcaccaagaaggcagcttga

DBGET integrated database retrieval system