KEGG   Mus musculus (mouse): 15364
Entry
15364             CDS       T01002                                 

Symbol
Hmga2, 9430083A20Rik, HMGI-C, Hmgic, pg, pygmy
Name
(RefSeq) high mobility group AT-hook 2
  KO
K09283  high mobility group AT-hook protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15364 (Hmga2)
   05206 MicroRNAs in cancer
    15364 (Hmga2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15364 (Hmga2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    15364 (Hmga2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other transcription factors
   HMGI(Y)
    15364 (Hmga2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    15364 (Hmga2)
SSDB
Motif
Pfam: AT_hook
Other DBs
NCBI-GeneID: 15364
NCBI-ProteinID: NP_034571
MGI: 101761
Ensembl: ENSMUSG00000056758
Vega: OTTMUSG00000033206
UniProt: P52927
Position
10:complement(120197173..120312374)
AA seq 108 aa
MSARGEGAGQPSTSAQGQPAAPVPQKRGRGRPRKQQQEPTCEPSPKRPRGRPKGSKNKSP
SKAAQKKAETIGEKRPRGRPRKWPQQVVQKKPAQETEETSSQESAEED
NT seq 327 nt   +upstreamnt  +downstreamnt
atgagcgcacgcggtgagggcgccgggcagccgtccacatcagcccagggacaacctgcc
gccccggtgccacagaagcgaggacgcggccgacccaggaagcagcagcaagagccaacc
tgtgagccctctcctaagagacccagaggaagacccaaaggcagcaaaaacaagagcccc
tctaaagcagcccagaagaaagcagagaccattggagaaaaacggccaagaggcagacct
aggaaatggccacaacaagtcgttcagaagaagcctgctcaggagactgaagagacatcc
tcgcaagagtccgcagaggaggattag

DBGET integrated database retrieval system