KEGG   Mus musculus (mouse): 15366
Entry
15366             CDS       T01002                                 

Gene name
Hmmr, AA386826, CD168, Rha, Rhamm
Definition
(RefSeq) hyaluronan mediated motility receptor (RHAMM)
  KO
K06267  hyaluronan-mediated motility receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    15366 (Hmmr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    15366 (Hmmr)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15366 (Hmmr)
CD molecules [BR:mmu04090]
 Proteins
  15366 (Hmmr)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Cell surface receptors
   15366 (Hmmr)
SSDB
Motif
Pfam: HMMR_N HMMR_C TPR_MLP1_2
Other DBs
NCBI-GeneID: 15366
NCBI-ProteinID: NP_038580
MGI: 104667
Ensembl: ENSMUSG00000020330
Vega: OTTMUSG00000005436
UniProt: Q00547 Q3UPW7
Position
11 A5; 11 24.4 cM
AA seq 794 aa
MSFPKAPLKRFNDPSGCAPSPGAYDVKTSEATKGPVSFQKSQRFKNQRESQQNLNIDKDT
TLLASAKKAKKSVSKKDSQKNDKDVKRLEKEIRALLQERGTQDKRIQDMESELEKTEAKL
NAAVREKTSLSASNASLEKRLTELTRANELLKAKFSEDGHQKNMRALSLELMKLRNKRET
KMRSMMVKQEGMELKLQATQKDLTESKGKIVQLEGKLVSIEKEKIDEKCETEKLLEYIQE
ISCASDQVEKCKVDIAQLEEDLKEKDREILSLKQSLEENITFSKQIEDLTVKCQLLETER
DNLVSKDRERAETLSAEMQILTERLALERQEYEKLQQKELQSQSLLQQEKELSARLQQQL
CSFQEEMTSEKNVFKEELKLALAELDAVQQKEEQSERLVKQLEEETKSTAEQLTRLDNLL
REKEVELEKHIAAHAQAILIAQEKYNDTAQSLRDVTAQLESVQEKYNDTAQSLRDVTAQL
ESEQEKYNDTAQSLRDVTAQLESEQEKYNDTAQSLRDVTAQLESVQEKYNDTAQSLRDVT
AQLESYKSSTLKEIEDLKLENLTLQEKVAMAEKSVEDVQQQILTAESTNQEYARMVQDLQ
NRSTLKEEEIKEITSSFLEKITDLKNQLRQQDEDFRKQLEEKGKRTAEKENVMTELTMEI
NKWRLLYEELYEKTKPFQQQLDAFEAEKQALLNEHGATQEQLNKIRDSYAQLLGHQNLKQ
KIKHVVKLKDENSQLKSEVSKLRSQLVKRKQNELRLQGELDKALGIRHFDPSKAFCHASK
ENFTPLKEGNPNCC
NT seq 2385 nt   +upstreamnt  +downstreamnt
atgtcctttcctaaggcgcccctgaagagattcaatgacccttcgggttgtgctccatct
ccgggtgcttatgatgttaaaacttcagaagcaactaaaggaccagtgtcttttcagaaa
tcacaaagatttaaaaaccaaagagagtctcaacaaaatcttaacattgacaaagataca
accttgcttgcttcggctaaaaaagcaaagaagtctgtgtcaaagaaggactctcagaag
aatgataaagatgtgaagagattagaaaaagagattcgcgctcttttgcaagagcgaggg
actcaggacaaacggatccaggacatggaatctgaattggagaagacagaagcaaagctc
aatgcagcagtcagagagaaaacatctctctctgcgagtaatgcttcactggaaaaacgg
cttactgaattaaccagagccaacgagctactaaaggctaagttttctgaagatggtcac
caaaagaatatgagagctctaagcctggaattgatgaaactcagaaataagagagagaca
aagatgaggagtatgatggtcaaacaggaaggcatggagctgaagctgcaggccactcag
aaggacctcacggagtctaagggaaaaatagtccagctggagggaaagcttgtttcaata
gagaaagaaaagatcgatgaaaaatgtgaaacagaaaaactcttagaatacatccaagaa
attagctgtgcatctgatcaagtggaaaaatgcaaagtagatattgcccagttagaagaa
gatttgaaagagaaggatcgtgagattttaagtcttaagcagtctcttgaggaaaacatt
acattttctaagcaaatagaagacctgactgttaaatgccagctacttgaaacagaaaga
gacaaccttgtcagcaaggatagagaaagggctgaaactctcagtgctgagatgcagatc
ctgacagagaggctggctctggaaaggcaagaatatgaaaagctgcaacaaaaagaattg
caaagccagtcacttctgcagcaagagaaggaactgtctgctcgtctgcagcagcagctc
tgctctttccaagaggaaatgacttctgagaagaacgtctttaaagaagagctaaagctc
gccctggctgagttggatgcggtccagcagaaggaggagcagagtgaaaggctggttaaa
cagctggaagaggaaacgaagtcaactgcagaacaactgacgcggctggacaacctgctg
agagagaaagaagttgaactggagaaacatattgctgctcacgcccaagccatcttgatt
gcacaagagaagtataatgacacagcacagagtctgagggacgtcactgctcagttggaa
agtgtgcaagagaagtataatgacacagcacagagtctgagggacgtcactgctcagttg
gaaagtgagcaagagaagtacaatgacacagcacagagtctgagggacgtcactgctcag
ttggaaagtgagcaagagaagtacaatgacacagcacagagtctgagggacgtcactgct
cagttggaaagtgtgcaagagaagtacaatgacacagcacagagtctgagggacgtcact
gctcagttggaaagctataagtcatcaacacttaaagaaatagaagatcttaaactggag
aatttgactctacaagaaaaagtagctatggctgaaaaaagtgtagaagatgttcaacag
cagatattgacagctgagagcacaaatcaagaatatgcaaggatggttcaagatttgcag
aacagatcaaccttaaaagaagaagaaattaaagaaatcacatcttcatttcttgagaaa
ataactgatttgaaaaatcaactcagacaacaagatgaagactttaggaagcagctggaa
gagaaaggaaaaagaacagcagagaaagaaaatgtaatgacagaattaaccatggaaatt
aataaatggcgtctcctatatgaagaactatatgaaaaaactaaaccttttcagcaacaa
ctggatgcctttgaagccgagaaacaggcattgttgaatgaacatggtgcaactcaggag
cagctaaataaaatcagagactcctatgcacagctacttggtcaccagaacctaaagcaa
aaaatcaaacatgttgtgaaattgaaagatgaaaatagccaactcaaatcggaggtgtca
aaactccgatctcagcttgttaaaaggaaacaaaatgagctcagacttcagggagaatta
gataaagctctgggcatcagacactttgacccttccaaggctttttgtcatgcatctaag
gagaattttactccattaaaagaaggcaacccaaactgctgctga

DBGET integrated database retrieval system