KEGG   Mus musculus (house mouse): 15374
Entry
15374             CDS       T01002                                 
Symbol
Jpt1, Hn1
Name
(RefSeq) Jupiter microtubule associated homolog 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: JUPITER
Other DBs
NCBI-GeneID: 15374
NCBI-ProteinID: NP_032284
MGI: 1096361
Ensembl: ENSMUSG00000020737
UniProt: P97825
Position
11:complement(115388171..115405219)
AA seq 154 aa
MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPP
SWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQME
EKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG
NT seq 465 nt   +upstreamnt  +downstreamnt
atgaccactaccactacctttaagggtgtggaccctaacagcaggaacagctcccgggtt
ttgcggcctccaggtggtgggtccaatttttcattaggctttgatgagccagcagaacag
cctgtgaggaagaacaagatggcttctaacatctttgggacaccggaagagaacccccca
tcttgggccaagtcagcaggttccaagtctagtggtggcagggaagattcggagtcgcct
ggaacacagagaagtaactcttctgaagcaagctctggagatttcttagacctcaaggga
gaaggtgatatgcatgaaaatgtggacacagacttccaagccaacctggcgcagatggag
gagaagccagtgcccgctgctcctgtgcccagcccagtggctccagccccagtgccatcc
aggagaaacccccctggcggcaagtccagcctggtcttgggttag

DBGET integrated database retrieval system