KEGG   Mus musculus (mouse): 15376
Entry
15376             CDS       T01002                                 

Gene name
Foxa2, HNF3-be, HNF3-beta, HNF3be, HNF3beta, Hnf-3, Hnf-3b, Hnf3, Hnf3b, Tcf-3b, Tcf3b
Definition
(RefSeq) forkhead box A2
  KO
K08035  forkhead box protein A2, hepatocyte nuclear factor 3-beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    15376 (Foxa2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    15376 (Foxa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15376 (Foxa2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    15376 (Foxa2)
SSDB
Motif
Pfam: Forkhead HNF_C Forkhead_N
Other DBs
NCBI-GeneID: 15376
NCBI-ProteinID: NP_034576
MGI: 1347476
Ensembl: ENSMUSG00000037025
Vega: OTTMUSG00000015678
UniProt: P35583
Position
2 G3; 2 73.38 cM
AA seq 459 aa
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGGGSGNMSA
GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGA
MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML
TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSG
NMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPA
GTESPHSSASPCQEHKRGGLSELKGAPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLP
PEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGGYGSPM
PGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgctgggagccgtgaagatggaagggcacgagccatccgactggagcagctactacgcg
gagcccgagggctactcttccgtgagcaacatgaacgccggcctggggatgaatggcatg
aacacatacatgagcatgtccgcggctgccatgggcggcggttccggcaacatgagcgcg
ggctccatgaacatgtcatcctatgtgggcgctggaatgagcccgtcgctagctggcatg
tccccgggcgccggcgccatggcgggcatgagcggctcagccggggcggccggcgtggcg
ggcatgggacctcacctgagtccgagtctgagcccgctcgggggacaggcggccggggcc
atgggtggccttgccccctacgccaacatgaactcgatgagccccatgtacgggcaggcc
ggcctgagccgcgctcgggaccccaagacataccgacgcagctacacacacgccaaacct
ccctactcgtacatctcgctcatcaccatggccatccagcagagccccaacaagatgctg
acgctgagcgagatctatcagtggatcatggacctcttccctttctaccggcagaaccag
cagcgctggcagaactccatccgccactctctctccttcaacgactgctttctcaaggtg
ccccgctcgccagacaagcctggcaagggctccttctggaccctgcacccagactcgggc
aacatgttcgagaacggctgctacctgcgccgccagaagcgcttcaagtgtgagaagcaa
ctggcactgaaggaagccgcgggtgcggccagtagcggaggcaagaagaccgctcctggg
tcccaggcctctcaggctcagctcggggaggccgcgggctcggcctccgagactccggcg
ggcaccgagtccccccattccagcgcttctccgtgtcaggagcacaagcgaggtggccta
agcgagctaaagggagcacctgcctctgcgctgagtcctcccgagccggcgccctcgcct
gggcagcagcagcaggctgcagcccacctgctgggcccacctcaccacccaggcctgcca
ccagaggcccacctgaagcccgagcaccattacgccttcaaccaccccttctctatcaac
aacctcatgtcgtccgagcagcaacatcaccacagccaccaccaccatcagccccacaaa
atggacctcaaggcctacgaacaggtcatgcactacccagggggctatggttcccccatg
ccaggcagcttggccatgggcccagtcacgaacaaagcgggcctggatgcctcgcccctg
gctgcagacacttcctactaccaaggagtgtactccaggcctattatgaactcatcctaa

DBGET integrated database retrieval system