KEGG   Mus musculus (mouse): 15384Help
Entry
15384             CDS       T01002                                 

Gene name
Hnrnpab, 3010025C11Rik, CBF-A, Cgbfa, Hnrpab
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A/B
  KO
K13044  heterogeneous nuclear ribonucleoprotein A/B/D
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    15384 (Hnrnpab)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    15384 (Hnrnpab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 CBFNT RRM_7 Nup35_RRM_2 RRM_3 NID DUF2462 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 15384
NCBI-ProteinID: NP_034578
MGI: 1330294
Ensembl: ENSMUSG00000020358
Vega: OTTMUSG00000005602
UniProt: Q99020 Q544Z3
Position
11; 11 B1.3
AA seq 285 aa AA seqDB search
MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGA
EGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF
ILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFG
QFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVY
QQQQYGSGGRGNRNRGNRGSGGGQGSTNYGKSQRRGGHQNNYKPY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgcggctgaggagcagcccatggagacgacgggcgccaccgagaacggacac
gaggccgcccccgaaggcgaggccccggtcgagcccagcgcggctgccgcggcccccgcg
gcctcggccgggtctgggggcgggaccacgaccgcaccgagcgggaaccagaacggcgcg
gagggcgaccagatcaacgccagcaagaacgaggaggacgcgggaaaaatgttcgttggt
ggtctgagctgggataccagcaaaaaagacttaaaggattattttactaagtttggagag
gttgttgactgtacaataaaaatggatcccaacactggacgatcaagagggtttgggttt
attctcttcaaagattcttctagtgtggaaaaggtcttagatcagaaggagcacaggctg
gatggtcgtgtcattgaccctaaaaaggctatggctatgaagaaggaccctgtgaagaaa
atctttgtgggaggtctaaaccctgaagccacagaggaaaagatcagagaatacttcggc
cagtttggggagattgaggccattgagcttccaatagatcccaagttgaacaaaagacgg
ggttttgtttttattacatttaaagaggaagatcctgtgaagaaagttctggagaagaaa
tttcatactgtcagtggaagcaagtgtgaaatcaaggttgcccagcccaaagaggtgtat
cagcaacagcagtatggctctgggggcagaggaaatcgcaatcgagggaaccgaggcagt
ggtggaggtcagggtagtacaaattacggaaagagccagcgacgtggtggtcatcagaat
aactacaagccatactga

DBGET integrated database retrieval system