KEGG   Mus musculus (mouse): 15395
Entry
15395             CDS       T01002                                 

Symbol
Hoxa10, Hox-1.8, Hoxa-10
Name
(RefSeq) homeobox A10
  KO
K17443  homrobox protein Hox-A10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15395 (Hoxa10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15395 (Hoxa10)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    15395 (Hoxa10)
SSDB
Motif
Pfam: Homeodomain MIC19_MIC25 Homeobox_KN
Other DBs
NCBI-GeneID: 15395
NCBI-ProteinID: NP_032289
MGI: 96171
Ensembl: ENSMUSG00000000938
Vega: OTTMUSG00000018886
UniProt: P31310
Position
6:complement(52208177..52217834)
AA seq 416 aa
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHG
GVYLPPASDLPYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWL
DAPRSCRMEPPDGPPPPQPQPQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLY
DAADKCPKGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQAYGTAKGFGSGGGGT
QQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEAHA
SSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYTKHQTLELEKE
FLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgtcagccagaaagggctatctgctcccttcgccaaattatcccacaacaatgtcatgc
tcggagagccctgccgcgaactcctttttggtcgactcgctcatcagctcaggcagaggc
gaggctggtgttggtggcggtagcgcggggggcggtggaggtggctactacgcccacggt
ggggtctacctgccgcctgccagcgacctgccctacgggctgcaaagctgcgggctcttc
cccgcgctgggcagcaagcgtaatgaagcgccgtcgcccggaggcggtggcggtggtggc
agcgggggcctgggtcctgggacgcatggctacgcgcccgcgcccctagacctgtggctg
gacgcgccccgctcctgccggatggagccgcccgacgggccgccgccaccgcagccacaa
ccccagcagcagcagcagcagccgccgccgcccccgccgcagccacctcaaccccagcca
caggccacttcgtgttcttttgcgcagaacatcaaagaagagagctcctactgcctctac
gatgctgcggacaaatgccccaagggctcggccgccgctgatctggcccctttcccgcgg
ggcccgccgcccgacggctgcgccctgggcgcctccagcggagtgccagtacccggctac
ttccgcctgtcgcaggcctacggcacggccaagggcttcggcagtggcggcggcggcacg
cagcagctcgctagtccctttcctgcgcagcccccggggcgcggtttcgacccgccgccc
gcactggcctctggctcgaccgaggcagccgggaaggagcgagtcctagactccacgcca
ccacccactctggtttgcaccggtggcggcggctcgcagggcgacgaggaggcacacgcg
tcatcctcggcggctgaggagctgtctccagccccttcagaaaacagtaaagcttcgccg
gagaaggactccctgggcagttccaaaggcgaaaatgcagccaactggctcacagcaaag
agcggccggaagaaacgctgcccttacacgaagcaccagacgctggagctggagaaggag
tttctattcaacatgtaccttactcgagagcggcgcctagagatcagccgtagcgtccac
ctcacggacagacaagtgaaaatctggtttcagaatcgcaggatgaaactgaagaaaatg
aaccgagaaaaccgaatccgggagctcacagccaactttaatttttcctga

DBGET integrated database retrieval system