KEGG   Mus musculus (mouse): 15396
Entry
15396             CDS       T01002                                 

Gene name
Hoxa11, Hox-1.9, Hoxa-11
Definition
(RefSeq) homeobox A11
  KO
K21951  homeobox protein Hox-A11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15396 (Hoxa11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15396 (Hoxa11)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    15396 (Hoxa11)
SSDB
Motif
Pfam: DUF3528 Homeodomain Dehydrin Homeobox_KN
Other DBs
NCBI-GeneID: 15396
NCBI-ProteinID: NP_034580
MGI: 96172
Ensembl: ENSMUSG00000038210
Vega: OTTMUSG00000018883
UniProt: P31311
Position
6 B3; 6 25.4 cM
AA seq 313 aa
MMDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVRE
VTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPT
PAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKNAEKGPQAAAATSAAA
VAAAATGAPATSSSDGGGGGGCQEAAAEEKERRRRPESSSSPESSSGHTEDKAGGSGGQR
TRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKIN
RDRLQYYSANPLL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgatggattttgatgagcgtggtccctgctcctctaacatgtatttgccaagttgtact
tactacgtctcgggtccagatttctccagcctcccttcttttttgccccagaccccgtct
tcgcgcccaatgacatactcctactcctccaacctgccccaggtccaacccgtgcgcgaa
gtgaccttcagagagtacgccattgagcccgccactaaatggcacccccgcggcaatctg
gcccactgctactccgcggaggagctcgtgcacagagactgtctgcaggcgcccagcgcg
gccggcgtgcctggcgacgtgctggccaagagctcggccaacgtctaccaccaccccacc
cccgccgtctcgtccaatttctatagcacggtgggcaggaacggcgttctgccacaggct
ttcgaccagtttttcgagacggcttacggcaccccggaaaacctcgcttcctccgactac
cccggggacaagaacgccgagaaggggccccaagcagcagctgcgacctccgctgcggcg
gtggcggcggcggccacgggcgcgccggcaacttcaagttcggacggcggcggtggcggc
ggctgtcaggaggcggcggcggaggagaaggagcgacggcggcgacccgagagcagcagc
agccccgagtcgtcttccggccacactgaggacaaggccggtggctccggtggccaacgc
acccgcaaaaagcgctgcccttataccaaataccagatccgagagctggagcgagagttc
ttcttcagcgtctacatcaacaaagagaagcgtctgcaactgtcccgcatgctcaacctc
accgaccgtcaagtcaaaatctggtttcagaacagaagaatgaaggaaaaaaagattaac
agagaccggttacagtactactcagctaatccacttctctaa

DBGET integrated database retrieval system