KEGG   Mus musculus (mouse): 15403Help
Entry
15403             CDS       T01002                                 

Gene name
Hoxa6, Hox-1.2
Definition
(RefSeq) homeobox A6
  KO
K09306  homeobox protein HoxA/B/C6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15403 (Hoxa6)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    15403 (Hoxa6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Terminase_5
Motif
Other DBs
NCBI-GeneID: 15403
NCBI-ProteinID: NP_034584
MGI: 96178
Ensembl: ENSMUSG00000043219
Vega: OTTMUSG00000018882
UniProt: P09092 Q0VEU7
Position
6 B3; 6 25.4 cM
AA seq 232 aa AA seqDB search
MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQ
SNSVLACNRASYEYGASCFYSDKDLSGASPSGNNKQRGPGDYLHFSPEQQYKPDGSVQGK
ALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLT
RRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAKAGE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctattttgtgaatcccactttccctgggagcctgcccagcggccaggactcc
ttcttgggccagctgcccctctacccggccggctatgacgcgctgaggcccttcccggcc
tcttacggggcgtcgagtcttccggacaagacatacacctcaccttgtttttaccaacag
tccaactcggtcttggcctgcaaccgggcatcctacgagtacggggcctcatgtttctat
tctgataaagacctcagtggcgcctcaccctcgggcaataacaagcagaggggccccggg
gactacctgcacttttctcccgagcagcagtacaaacctgacggcagcgtgcagggcaaa
gccctccatgaggaaggcaccgaccggaagtacacaagccctgtttacccctggatgcag
cggatgaattcctgtgcgggtgccgtgtatgggagtcacgggcgcagaggccgccagacc
tacacgcgctaccagacactggagcttgagaaggaattccacttcaaccgctacctgact
cggcggcgccgcatcgagatcgctaacgcgctttgcctcaccgagcgccagatcaagatc
tggttccagaatcggcgcatgaagtggaaaaaggaaaataaactcatcaactccacgcag
gccagcggggaagactctgaggccaaagcgggcgagtag

DBGET integrated database retrieval system