KEGG   Mus musculus (house mouse): 15404
Entry
15404             CDS       T01002                                 
Symbol
Hoxa7, Hox-1.1, M6
Name
(RefSeq) homeobox A7
  KO
K09307  homeobox protein HoxA/B7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15404 (Hoxa7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    15404 (Hoxa7)
SSDB
Motif
Pfam: Homeodomain Ribosomal_60s
Other DBs
NCBI-GeneID: 15404
NCBI-ProteinID: NP_034585
MGI: 96179
Ensembl: ENSMUSG00000038236
UniProt: P02830
Position
6:complement(52192603..52195553)
AA seq 229 aa
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASTVPGLYNVNSP
LYQSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYP
WMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR
RMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEEEEEEEEE
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagttcttcgtattatgtgaacgcgctttttagcaaatatacggcgggggcttctctc
ttccaaaatgccgagccgacttcttgctcctttgcacccaactcgcagagaagcggctac
gggccgggcgccggcgccttcgcctccactgtgccgggcttatacaatgtcaacagcccc
ctctatcagagccccttcgcgtccggctatggcctgggagccgacgcctacaacctgccc
tgcgcctcctacgaccaaaacatccccgggctctgcagtgacctcgccaaaggcgcctgc
gacaaggcggacgagggcgtgcttcacggcccggccgaagccagtttccgcatctacccc
tggatgcgcagttcaggacccgacaggaagcggggacgccagacctacacgcgctaccag
acgctggaactggagaaggaattccatttcaaccgctacctgacgcggcgccgccgcatc
gagatcgctcacgcgctctgcctcactgagcgccagatcaagatctggttccagaatcgg
cgcatgaagtggaagaaagagcataaagatgagagccaggctcccactgcagccccggaa
gacgcggtgccctccgtttccacagctgctgacaaggcggacgaggaggaagaggaggaa
gaggaggaagaagaggaggaagaggagtaa

DBGET integrated database retrieval system