KEGG   Mus musculus (mouse): 15405Help
Entry
15405             CDS       T01002                                 

Gene name
Hoxa9, D6a9, Hox-1.7
Definition
(RefSeq) homeobox A9
  KO
K21950  homeobox protein Hox-A9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    15405 (Hoxa9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15405 (Hoxa9)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    15405 (Hoxa9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hox9_act Homeodomain HTH_23
Motif
Other DBs
NCBI-GeneID: 15405
NCBI-ProteinID: NP_034586
MGI: 96180
Ensembl: ENSMUSG00000038227
Vega: OTTMUSG00000018873
UniProt: P09631
Structure
PDB: 

Position
6 B3; 6 25.4 cM
AA seq 271 aa AA seqDB search
MATTGALGNYYVDSFLLGADAADELGAGRYAPGTLGQPPRQAAALAEHPDFSPCSFQSKA
AVFGASWNPVHAAGANAVPAAVYHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSF
AGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAE
NESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVAR
LLNLTERQVKIWFQNRRMKMKKINKDRAKDE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccggggccctgggcaactactatgtggactccttcctgctgggcgccgac
gctgctgatgagctgggtgcgggacgctacgctccagggaccctgggtcaacccccaagg
caggcggcagctctggccgaacaccccgacttcagtccttgcagcttccagtccaaggcg
gcggtgtttggtgcctcgtggaacccagtgcacgcggcgggcgccaatgcggtgcctgct
gcagtgtatcatcaccaccaccacccctacgtgcatccccaggcgcccgtggcggcggcg
gcgccggacggcaggtatatgcgctcctggctggaacccacgcccggtgcgctctccttc
gcgggcttaccctccagccggccttatggcattaaacctgaaccgctctcggccagaagg
ggtgactgtcccacgcttgacactcacactttgtccctgactgactatgcttgtggttct
cctccagttgatagagaaaaacaacccagcgaaggcgccttctccgaaaacaatgccgag
aatgagagcggcggagacaagccccccatcgatcccaataacccggctgccaactggcta
catgctcgctccactcggaagaagcgatgcccctacacaaaacaccagacgctggaactg
gagaaggagtttctgtttaacatgtacctcacacgggaccgcaggtacgaggtggcccgg
ctgctcaacctcaccgaaaggcaggtcaagatctggttccagaaccgcaggatgaaaatg
aagaaaatcaacaaggaccgagcaaaagacgagtga

DBGET integrated database retrieval system