KEGG   Mus musculus (house mouse): 15415
Entry
15415             CDS       T01002                                 
Symbol
Hoxb7, AI325018, Hox-2.3
Name
(RefSeq) homeobox B7
  KO
K09307  homeobox protein HoxA/B7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15415 (Hoxb7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    15415 (Hoxb7)
SSDB
Motif
Pfam: Homeodomain DUF2209 Homeobox_KN
Other DBs
NCBI-GeneID: 15415
NCBI-ProteinID: NP_034590
MGI: 96188
Ensembl: ENSMUSG00000038721
UniProt: P09024
Position
11:96176431..96180989
AA seq 217 aa
MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASVQGLYS
GGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAA
ESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQ
IKIWFQNRRMKWKKENKTSGPGTTGQDKAEAEEEEEE
NT seq 654 nt   +upstreamnt  +downstreamnt
atgagttcattgtattatgcgaatgctttattttctaaatatccagccgcaagttcggtt
ttcgctccaggagccttccccgaacaaacttcttgcgcctttgcttccaacccccagcgc
ccgggctatggagcaggtccgggcgctcctttctccgcctcggtgcagggtctgtactcc
ggcgggggggccatggcgggccagagcgcggctggcgtctatgcggccggctacgggctc
gaaccgagttccttcaacatgcactgcgcgccctttgagcagaacctctccggggtgtgt
ccgggcgaccccgccaaggcggctggcgccaaggagcagagggactcggacttggcggcc
gagagtaacttccggatctacccctggatgcgaagctcagggcctgaccgaaagcgaggc
cgccagacctacacgcgctaccagaccctggagctggagaaagaatttcactacaatcgc
tacctgactcggcggaggcgcatcgagatcgcgcacacgctctgcctcaccgaaagacag
atcaagatctggtttcagaaccggcgcatgaagtggaaaaaggagaacaaaacctcagga
ccgggaaccaccggccaggacaaggcggaagcggaggaggaggaggaagagtga

DBGET integrated database retrieval system