KEGG   Mus musculus (mouse): 15417
Entry
15417             CDS       T01002                                 

Symbol
Hoxb9, Hox-2.5
Name
(RefSeq) homeobox B9
  KO
K09294  homeobox protein HoxB/C/D9
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15417 (Hoxb9)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    15417 (Hoxb9)
SSDB
Motif
Pfam: Hox9_act Homeodomain HTH_23 Homeobox_KN CI-B14_5a
Other DBs
NCBI-GeneID: 15417
NCBI-ProteinID: NP_032296
MGI: 96190
Ensembl: ENSMUSG00000020875
Vega: OTTMUSG00000001991
UniProt: P20615
Position
11:96162156..96167421
AA seq 250 aa
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFG
ASWAPLSPHASGSLPSVYHPYLQPQGAPAAESRYLRTWLEPAPRAEAAPGQGQAAVKAEP
LLGAPGELLKQGTPEYSLETSAGREAVLSNQRAGYGDNKICEGSEDKERPDQTNPSANWL
HARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKM
KKMNKEQGKE
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtccatttctgggacgcttagcagctattatgtcgactcgatcataagtcacgagagc
gaggacgcgcctccagccaagtttccttcgggccagtacgcgaacccgcggcagccgggc
cacgccgagcacctggacttcccctcgtgcagcttccagcccaaagcgccggtgttcggc
gcctcctgggcgccgctgagcccgcacgcctcggggagcctgccgtctgtctaccacccc
tacctgcagccccagggcgcgccggcggccgaaagcaggtacctccgcacctggctagag
ccggcgccgcgcgccgaggccgccccggggcagggccaggcggccgtgaaggcggagccg
ctgctgggcgcgccgggggagctgctcaaacagggcacgcccgagtacagtttggaaact
tcggcgggcagggaggctgtcctgtctaatcaaagagctggctacggggacaataaaatt
tgcgaaggaagcgaggacaaagagaggccggatcaaaccaacccctctgccaactggctg
cacgcccgctcttcccggaaaaagcgctgtccctacaccaaataccagacgctggagcta
gagaaggagtttctgttcaatatgtacctcaccagggaccgcaggcatgaagtggccaga
ctcctcaatctgagtgagagacaagtcaaaatctggtttcagaaccggcggatgaaaatg
aagaagatgaataaggagcagggcaaagagtaa

DBGET integrated database retrieval system