KEGG   Mus musculus (mouse): 15424
Entry
15424             CDS       T01002                                 

Symbol
Hoxc5, AI181837, Hox-3.4, Hox-6.2
Name
(RefSeq) homeobox C5
  KO
K09305  homeobox protein HoxA/B/C5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15424 (Hoxc5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    15424 (Hoxc5)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 15424
NCBI-ProteinID: NP_783857
MGI: 96196
Ensembl: ENSMUSG00000022485
Vega: OTTMUSG00000037400
UniProt: P32043
Position
15:102922440..102925861
AA seq 222 aa
MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHG
VDMAANPRAHPDRPACSAAAAPGHALGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKE
EQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYL
TRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL
NT seq 669 nt   +upstreamnt  +downstreamnt
atgagctcctacgtagccaattcattctataagcagagccccaatatccctgcctataac
atgcaaacttgtgggaactatggatcggcctcagaggtgcaggcatccaggtactgctac
ggcggattggacttaagcatcactttcccaccgcctgcgccttccaactctctccacggg
gtagacatggctgccaacccccgggctcaccccgaccgccccgcctgcagcgccgcggcc
gctccgggacacgctctgggcagagacgaagcggctcctctgaaccctgggatgtacagt
cagaaggcggctcgcccggcgctggaggagcgagctaagagcagtggggagatcaaagag
gagcaggcgcagacagggcagcctgccggactgagccagccaccggccccgccacagatt
tacccgtggatgaccaaactgcacatgagccacgagacggatggcaagcggtcccgaacc
agttacacgcgctaccagaccctggaactcgagaaagaattccattttaaccgctacctc
actcgccgcaggcgcatagagattgccaacaacttgtgtctcaacgagagacagatcaag
atctggttccagaaccgcaggatgaagtggaagaaagattccaaaatgaagagcaaagaa
gctctttag

DBGET integrated database retrieval system