KEGG   Mus musculus (mouse): 15430
Entry
15430             CDS       T01002                                 

Gene name
Hoxd10, AI385591, AI874987, Hox-4.5, Hox-5.3
Definition
(RefSeq) homeobox D10
  KO
K09295  homrobox protein Hox-D10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    15430 (Hoxd10)
   05205 Proteoglycans in cancer
    15430 (Hoxd10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15430 (Hoxd10)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    15430 (Hoxd10)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 15430
NCBI-ProteinID: NP_038582
MGI: 96202
Ensembl: ENSMUSG00000050368
Vega: OTTMUSG00000016554
UniProt: P28359
Position
2 C3; 2 44.13 cM
AA seq 340 aa
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKR
EVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTANIKEESNCCMYSDKR
NKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQL
NPRGAAKPQLSAAQLQMEKKMNESASGQEPTKVSQVESPEAKGGLPEDRSCLAEVSVSSP
EVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEIS
KSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcctttcccaacagctctcctgctgctaatacttttttagtagattccttgatcagt
gcctgcaggagtgacagtttttattcgagcagcgccagcatgtacatgccaccacctagc
gcagacatggggacctatggaatgcaaacctgtggactgctcccgtctttggccaaaaga
gaagtgaaccaccaaaatatgggtatgaatgtacatccttatatacctcaagtagacagt
tggacagacccgaacagatcttgtcgaatagagcaacctgttacacagcaagtccccact
tgctcattcaccgccaacattaaagaagaatccaattgctgcatgtattctgataagcgc
aacaaactcatttctgccgaggtcccttcgtaccagaggctggtccccgagtcttgtcct
gttgagaaccccgaggttcctgtccctggatattttagactgagtcagacctacgccacc
gggaaaacccaagagtacaataacagccccgaaggcagctccactgtcatgctccagctc
aaccctcgtggcgcggccaagccgcagctctcggctgcccagctgcagatggaaaagaag
atgaacgaaagcgcgagcggccaggagcccactaaagtctcccaagtggagagccccgag
gccaaaggcggccttccagaagacaggagctgcctggctgaggtttccgtgtccagtccc
gaagtgcaggagaaggaaagcaaagaggaaatcaagtctgatactccaaccagcaattgg
ctcactgcaaagagtggcagaaagaagaggtgcccttacaccaagcaccaaacgctggaa
ttggaaaaagagttcttgttcaatatgtacctcacccgcgagcgccgcctagagatcagt
aagagcgttaacctcaccgacaggcaggtcaagatttggtttcaaaaccgccgaatgaaa
ctcaagaagatgagccgagagaatcgaatccgagaactgaccgccaacctcaccttttct
tag

DBGET integrated database retrieval system