KEGG   Mus musculus (mouse): 15439Help
Entry
15439             CDS       T01002                                 

Gene name
Hp, HP-1, preHP2
Definition
(RefSeq) haptoglobin
  KO
K16142  haptoglobin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    15439 (Hp)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15439 (Hp)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   15439 (Hp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   15439 (Hp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF2476
Motif
Other DBs
NCBI-GeneID: 15439
NCBI-ProteinID: NP_059066
MGI: 96211
Ensembl: ENSMUSG00000031722
Vega: OTTMUSG00000061918
UniProt: Q61646 Q3UBS3
Position
8 D3; 8 57.11 cM
AA seq 347 aa AA seqDB search
MRALGAVVTLLLWGQLFAVELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRA
EGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKM
ISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLH
PNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYV
MLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAF
AIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagccctgggagctgttgtcactctcctgctctggggtcagctttttgctgtggag
ttgggcaatgatgccatggactttgaagatgacagctgcccaaagcccccagagattgca
aacggctatgtggagcacttggttcgctatcgctgccgacagttctacagactacgggcc
gaaggagatggggtgtacaccttaaacgacgagaagcaatgggtgaacacagtcgctgga
gagaaactccccgaatgtgaggcagtgtgtgggaagcccaagcaccctgtggaccaggtg
cagcgcatcatcggtggctctatggatgccaaaggcagctttccttggcaggccaagatg
atctcccgccacggactcaccaccggggccacgttgatcagtgaccagtggctgctgacc
acggccaaaaacctcttcctgaaccacagcgagacggcgtcagccaaggacatcaccccc
accctaacgctctacgtggggaaaaaccagctggtggagattgagaaggtcgttctccac
cccaaccactccgtggtggatatcgggctaatcaaactcaagcagagggtgcttgtaacc
gagagagtcatgcctatctgcctgccttccaaagactacatagcaccaggccgtgtgggc
tacgtgtctggctgggggcggaacgccaactttagatttaccgatcgtctcaagtatgtc
atgctgcctgtggccgaccaggacaagtgtgtggtgcactatgagaatagtacagtgccc
gagaagaaaaacttgacgagtcccgttggggtccagcctatcttgaacgagcacaccttc
tgtgctggcctcaccaagtaccaggaagacacctgctacggtgacgccggcagtgccttt
gccattcatgacatggaggaggacacctggtacgcagctgggatcctgagctttgacaag
agctgcgctgtcgctgagtatggtgtgtacgtgagggcgaccgacctgaaggactgggtt
caggaaaccatggccaagaactag

DBGET integrated database retrieval system