KEGG   Mus musculus (mouse): 15442Help
Entry
15442             CDS       T01002                                 

Gene name
Hpse, HSE1, Hpa, Hpr1
Definition
(RefSeq) heparanase
  KO
K07964  heparanase [EC:3.2.1.166]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00531  Glycosaminoglycan degradation
mmu01100  Metabolic pathways
mmu05205  Proteoglycans in cancer
Module
mmu_M00078  Heparan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    15442 (Hpse)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    15442 (Hpse)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15442 (Hpse)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     15442 (Hpse)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Enzymes
   15442 (Hpse)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_79n
Motif
Other DBs
NCBI-GeneID: 15442
NCBI-ProteinID: NP_690016
MGI: 1343124
Ensembl: ENSMUSG00000035273
Vega: OTTMUSG00000026166
UniProt: Q6YGZ1
Position
5; 5 E4
AA seq 535 aa AA seqDB search
MLRLLLLWLWGPLGALAQGAPAGTAPTDDVVDLEFYTKRPLRSVSPSFLSITIDASLATD
PRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPDKEPTSEERSYWKSQVNHDICR
SEPVSAAVLRKLQVEWPFQELLLLREQYQKEFKNSTYSRSSVDMLYSFAKCSGLDLIFGL
NALLRTPDLRWNSSNAQLLLDYCSSKGYNISWELGNEPNSFWKKAHILIDGLQLGEDFVE
LHKLLQRSAFQNAKLYGPDIGQPRGKTVKLLRSFLKAGGEVIDSLTWHHYYLNGRIATKE
DFLSSDVLDTFILSVQKILKVTKEITPGKKVWLGETSSAYGGGAPLLSNTFAAGFMWLDK
LGLSAQMGIEVVMRQVFFGAGNYHLVDENFEPLPDYWLSLLFKKLVGPRVLLSRVKGPDR
SKLRVYLHCTNVYHPRYQEGDLTLYVLNLHNVTKHLKVPPPLFRKPVDTYLLKPSGPDGL
LSKSVQLNGQILKMVDEQTLPALTEKPLPAGSALSLPAFSYGFFVIRNAKIAACI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggctgctgctgctgtggctctgggggccgctcggtgccctggcccagggcgcc
cccgcggggaccgcgccgaccgacgacgtggtagacttggagttttacaccaagcggccg
ctccgaagcgtgagtccctcgttcctgtccatcaccatcgacgccagcctggccaccgac
ccgcgcttcctcaccttcctgggctctccaaggctccgtgctctggctagaggcttatct
cctgcatacttgagatttggcggcacaaagactgacttccttatttttgatccggacaag
gaaccgacttccgaagaaagaagttactggaaatctcaagtcaaccatgatatttgcagg
tctgagccggtctctgctgcggtgttgaggaaactccaggtggaatggcccttccaggag
ctgttgctgctccgagagcagtaccaaaaggagttcaagaacagcacctactcaagaagc
tcagtggacatgctctacagttttgccaagtgctcggggttagacctgatctttggtcta
aatgcgttactacgaaccccagacttacggtggaacagctccaacgcccagcttctcctt
gactactgctcttccaagggttataacatctcctgggaactgggcaatgagcccaacagt
ttctggaagaaagctcacattctcatcgatgggttgcagttaggagaagactttgtggag
ttgcataaacttctacaaaggtcagctttccaaaatgcaaaactctatggtcctgacatc
ggtcagcctcgagggaagacagttaaactgctgaggagtttcctgaaggctggcggagaa
gtgatcgactctcttacatggcatcactattacttgaatggacgcatcgctaccaaagaa
gattttctgagctctgatgtgctggacacttttattctctctgtgcaaaaaattctgaag
gtcactaaagagatcacacctggcaagaaggtctggttgggagagacgagctcagcttac
ggtggcggtgcacccttgctgtccaacacctttgcagctggctttatgtggctggataaa
ttgggcctgtcagcccagatgggcatagaagtcgtgatgaggcaggtgttcttcggagca
ggcaactaccacttagtggatgaaaactttgagcctttacctgattactggctctctctt
ctgttcaagaaactggtaggtcccagggtgttactgtcaagagtgaaaggcccagacagg
agcaaactccgagtgtatctccactgcactaacgtctatcacccacgatatcaggaagga
gatctaactctgtatgtcctgaacctccataatgtcaccaagcacttgaaggtaccgcct
ccgttgttcaggaaaccagtggatacgtaccttctgaagccttcggggccggatggatta
ctttccaaatctgtccaactgaacggtcaaattctgaagatggtggatgagcagaccctg
ccagctttgacagaaaaacctctccccgcaggaagtgcactaagcctgcctgccttttcc
tatggtttttttgtcataagaaatgccaaaatcgctgcttgtatatga

DBGET integrated database retrieval system