KEGG   Mus musculus (mouse): 15444Help
Entry
15444             CDS       T01002                                 

Gene name
Hpca
Definition
(RefSeq) hippocalcin
  KO
K23846   
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 15444
NCBI-ProteinID: NP_001123891
MGI: 1336200
Ensembl: ENSMUSG00000028785
Vega: OTTMUSG00000009624
UniProt: P84075
Position
4; 4 D2.2
AA seq 193 aa AA seqDB search
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcagaacagcaagctgcggccagagatgctgcaggacctgcgagagaacacg
gagttctctgagctggagctacaggagtggtacaagggcttcctgaaggactgccccact
ggcatcctcaacgtggatgagttcaagaagatctacgccaacttcttcccctatggcgac
gcctccaagtttgccgagcacgtcttccgcacctttgacaccaacagcgacggcaccatc
gacttccgggagttcatcattgctctgagcgtgacctcgcgtggccgcctggagcagaag
ctcatgtgggccttcagcatgtatgacctggatggcaatggctacatcagccgggaggag
atgctagaaattgtgcaggccatttacaagatggtttcgtccgtgatgaaaatgcccgag
gatgagtcgaccccggaaaagaggactgagaaaatcttccgccaaatggacacaaacaat
gacggcaagctgtcgctggaggagttcatccgcggagccaaaagcgacccatccatcgtg
cgcctgctgcagtgtgatcccagcagcgcctcccagttctga

DBGET integrated database retrieval system