KEGG   Mus musculus (mouse): 15451
Entry
15451             CDS       T01002                                 

Gene name
Hpn, Hlb320
Definition
(RefSeq) hepsin
  KO
K08665  hepsin [EC:3.4.21.106]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15451 (Hpn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    15451 (Hpn)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.106  hepsin
     15451 (Hpn)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   15451 (Hpn)
SSDB
Motif
Pfam: Trypsin Hepsin-SRCR SRCR_2 Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 15451
NCBI-ProteinID: NP_001103722
MGI: 1196620
Ensembl: ENSMUSG00000001249
Vega: OTTMUSG00000036085
UniProt: O35453
Position
7; 7 B1
AA seq 436 aa
MAKEDEEPGAHRGGSTCSRPQPGKGGRTAACCSRPKVAALIVGTLLFLTGIGAASWAIVT
ILLQSDQEPLYQVQLSPGDSRLAVFDKTEGTWRLLCSSRSNARVAGLGCEEMGFLRALAH
SELDVRTAGANGTSGFFCVDEGGLPLAQRLLDVISVCDCPRGRFLTATCQDCGRRKLPVD
RIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGA
VARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEYIQPVCLPAA
GQALVDGKVCTVTGWGNTQFYGQQAMVLQEARVPIISNEVCNSPDFYGNQIKPKMFCAGY
PEGGIDACQGDSGGPFVCEDSISGTSRWRLCGIVSWGTGCALARKPGVYTKVTDFREWIF
KAIKTHSEASGMVTQP
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggcgaaggaggatgaggaacctggggctcacagaggaggttccacttgttcaagaccc
caacctggaaagggtggccggactgcagcatgctgctccagacccaaggtggcagctctc
attgtgggtaccctgctgttcctgacaggcattggggccgcgtcctgggccattgtgacc
atcctactgcagagtgaccaggagccactgtaccaagtgcagctcagtccaggggactca
cggcttgcggtgtttgacaagacggagggaacgtggaggctactgtgctcctcacgctcc
aatgccagggtggcagggctcggctgtgaggagatgggctttctcagggctctggcgcac
tcggagctggatgtgcgcactgcgggcgccaacggcacatcgggcttcttttgcgtggac
gagggcggactgcctctggctcagaggttgctggatgtcatctctgtatgtgactgtcct
agaggccgattcctgactgccacctgccaagactgtggccgcaggaagctgccggtggac
cgcattgtggggggccaggacagcagtctgggaaggtggccgtggcaggtcagcctgcgt
tatgatgggacccacctctgtggggggtccctgctgtctggggactgggtgctgactgct
gcacattgctttccagagcggaaccgggtcctgtctcggtggcgagtatttgctggtgct
gtagcccggacctcaccccatgctgtgcaactgggggttcaggctgtgatctatcatggg
ggctaccttccctttcgagaccctactatcgacgaaaacagcaatgacattgccttggtc
cacctctctagctccctgcctctcacagaatacatccagccagtgtgtctccctgctgcg
ggacaggccctggtggatggcaaggtctgtactgtgaccggctggggtaacacacagttc
tatggccaacaggctatggtgctccaagaggcccgggttcccatcataagcaacgaagtt
tgcaacagccccgacttctacgggaatcagatcaagcccaagatgttctgtgctggctat
cctgagggtggcattgatgcgtgccagggcgacagtggaggcccctttgtgtgtgaagac
agcatctctgggacatcaaggtggcggctatgtggcattgtaagctggggtacgggctgt
gctttggcccggaagccaggagtgtacaccaaagtcactgacttccgggagtggatcttc
aaggccataaagactcactccgaagccagtggcatggtgactcagccctga

DBGET integrated database retrieval system