KEGG   Mus musculus (mouse): 15467
Entry
15467             CDS       T01002                                 

Gene name
Eif2ak1, HCR, Hri
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05160  Hepatitis C
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15467 (Eif2ak1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    15467 (Eif2ak1)
   05160 Hepatitis C
    15467 (Eif2ak1)
   05168 Herpes simplex virus 1 infection
    15467 (Eif2ak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    15467 (Eif2ak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     15467 (Eif2ak1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   15467 (Eif2ak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH PKcGMP_CC
Other DBs
NCBI-GeneID: 15467
NCBI-ProteinID: NP_038585
MGI: 1353448
Ensembl: ENSMUSG00000029613
Vega: OTTMUSG00000025503
UniProt: Q9Z2R9
Position
5; 5 G2
AA seq 619 aa
MLGGSSVDGERDTDDDAAGAVAAPPAIDFPAEVSDPKYDESDVPAELQVLKEPLQQPTFP
FLVANQLLLVSLLEHLSHVHEPNPLHSKQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCQDNSYMQKIRSREIAFEAQTSRYLNEFEELAILGKGGYGR
VYKVRNKLDGQHYAIKKILIKSATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVV
QPQDRVPIQLPSLEVLSEQEGDRDQGGVKDNESSSSIVFAELTPEKEKPFGESEVKNENN
NLVSYTANLVVRNSSESESSIELQEDGLTDLSVRPVVRHQLPLGHSSELEGNFTSTDESS
EGNLNLLGQTEVRYHLMLHIQMQLCELSLWDWITERNKRSREYVDEAACPYVMASVATKI
FQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACADIIQNADWTNRNGKG
TRTHTSRVGTCLYASPEQLEGSQYDAKSDMYSLGVILLELFQPFGTEMERATVLTGVRTG
RIPESLSKRCPVQAKYIQLLTGRNVSQRPSALQLLQSELFQTTGNVNLTLQMKIIEQEKE
IEELKKQLSLLSQDRGLKR
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgctggggggcagctccgtggacggcgagcgcgacacggacgacgacgcggcgggggcg
gtggccgcgcctcctgccatcgacttccccgcagaggtgtcggaccccaagtatgatgag
tccgatgtccccgcagagctccaagtgttaaaagagcccctacagcagcccacgttccct
ttcctggtggcaaaccagctgctgctcgtctccttactggaacacttgagccatgtgcac
gagccaaacccgctccactccaaacaggtgtttaaattactgtgccagacttttatcaag
atggggctgctctcttcctttacctgcagtgatgagtttagctctctgagactccaccac
aacagagccatcactcatttaatgaggtctgccaaagagagagtccgtcaggatccttgt
caagataattcttacatgcagaaaatcagatccagagagatagccttcgaagcacaaacg
tcacgctacttaaatgaatttgaagagcttgccatcttagggaaaggaggatatggaaga
gtttacaaggtccggaacaaattagatggtcagcattatgcaattaagaaaatcctgatt
aagagcgcaactaaaacagattgtatgaaggtgctacgggaagtgaaggttctggcaggt
ctccagcatcccaatattgttggctaccacactgcgtggatagaacatgttcatgtggtt
cagccacaagacagagttccgattcaactgccctctctcgaagtgctgtcggagcaggaa
ggggacagagaccaaggtggtgttaaagataatgaaagcagttcgtccattgtctttgct
gaactcaccccagaaaaagaaaaaccttttggggagtctgaggttaaaaatgagaataac
aacctggtgagctacacggccaacttagtggtcaggaacagcagtgaaagtgaatcgtcc
attgagctccaagaagacggcttgactgatttgtccgtcagaccagttgtcaggcatcag
ctgccgctggggcatagctcggaattggaagggaattttacatccacggatgagtcttct
gaaggcaacttgaacctgctggggcagacggaggttcggtaccacctgatgttgcacatc
cagatgcagctgtgtgagctctccctgtgggactggataactgagaggaacaagcggagc
cgggagtatgtggacgaagctgcttgtccctatgttatggccagtgttgcaacaaaaatt
tttcaagaattggtggaaggtgtcttttacatacataacatgggcattgtccacagagat
ctgaagcctagaaatatttttcttcatggccctgatcagcaagtaaaaataggagacttt
ggtctggcctgtgcagacatcatccagaatgcagactggaccaacagaaatgggaaagga
acacggacacacacatccagagtggggacttgtctctacgcatcaccggaacagctggag
ggatcccagtacgatgccaagtcagatatgtatagcttgggtgtgatcctgctcgagctc
tttcagccattcgggacagaaatggagagggcaacagtcttaacaggcgtaaggactggt
cggatacccgaatccctcagtaaaaggtgtccggtgcaagccaagtatatccagctccta
accgggaggaatgtgtcacagagaccatctgcccttcagctgctgcagagtgagcttttt
caaacaactggaaatgttaatctcacattgcagatgaagataatagaacaagagaaggaa
attgaagaactaaagaagcaactaagcctcctttctcaggacagagggctgaagagatga

DBGET integrated database retrieval system