KEGG   Mus musculus (mouse): 15478
Entry
15478             CDS       T01002                                 

Symbol
Hs3st3a1, 3Ost3a, Hs3st3a
Name
(RefSeq) heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
  KO
K07809  [heparan sulfate]-glucosamine 3-sulfotransferase 3 [EC:2.8.2.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    15478 (Hs3st3a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    15478 (Hs3st3a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.30  [heparan sulfate]-glucosamine 3-sulfotransferase 3
     15478 (Hs3st3a1)
Glycosyltransferases [BR:mmu01003]
 Unclassified
  Sulfotransferases
   15478 (Hs3st3a1)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Sulfotransfer_2
Other DBs
NCBI-GeneID: 15478
NCBI-ProteinID: NP_849201
MGI: 1333861
Ensembl: ENSMUSG00000047759
Vega: OTTMUSG00000005895
UniProt: Q8BKN6 Q52KJ0
Position
11:64326158..64413667
AA seq 393 aa
MAPSGPTGAQPSPAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCPPGSGPVAGVPGRG
VPAGPRELAMWPAGAPRKRLLQLRQRRRRGRSGPGDSSDQEEQSPGLAAAPGGSGAGSSV
AEAQPGTLALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYH
KGLAWYRDLMPRTLEGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDY
TQTLSKRPDIPSFESLTFRNRSAGLIDTSWSAIQIGLYAKHLEPWLRHFPLGQMLFVSGE
RLVSDPAGELRRVQDFLGLKRIITDKHFYFNQTKGFPCLKKAEGSGKPHCLGKTKGRAHP
TIAREVLRQLRDFYRPFNRKFYQMTGRDFGWDG
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggccccctcgggtcccaccggcgcccagcccagcccggcggagccactgtcgcgcagc
atcttcaggaagttcttgctgatgctctgctcgctactcacttccctctacgtcttctac
tgcctggcggagcgctgcccacccggctcgggccccgtcgcgggggtcccggggcgcggc
gtccctgcaggacccagggaactggcgatgtggcccgcgggagcgccaaggaagcgcctc
ctgcagctgaggcaacggaggaggcgcgggcggtcggggccaggagacagcagcgaccag
gaggagcagagccctgggctggccgccgcaccaggaggctccggggcgggaagcagcgtg
gccgaggcccagccggggaccctggccttacttctggacgagggcagcaagcagctgccg
caggccatcatcatcggcgtgaagaagggcggcacgcgggcgctgctggagttcctgcgc
gtgcaccccgacgtgcgtgccgtgggtgctgagccccacttttttgaccgcagctaccac
aagggcctcgcctggtaccgggatttgatgcccagaaccctcgagggacagatcaccatg
gagaagacgcccagctactttgtgacccgggaggcacccgcgcgcatctcggccatgtcc
aaggacaccaaactcatcgtggtggtgcgcgacccggtgaccagggccatctcggactac
acgcagacgctgtccaagcggccggacatccccagcttcgagagcctgacgttccgcaac
cgcagcgcgggcctcatagacacgtcctggagcgccatccagatcggcctgtacgccaag
cacctggagccctggctgcgccacttcccgctcggccagatgctcttcgtgagcggggag
cggctggtcagcgacccggccggcgagctgcgccgcgtgcaggatttcctgggcctcaag
cgcatcatcaccgacaagcacttctacttcaaccagaccaagggcttcccgtgcctcaag
aaggcggagggcagcggcaagccgcactgcctgggcaagactaagggccgcgctcacccc
accattgcgcgggaggtgctgcggcagctgcgtgacttttaccggcccttcaaccgcaag
ttctaccagatgaccggccgcgactttggctgggatggatag

DBGET integrated database retrieval system