KEGG   Mus musculus (mouse): 15481Help
Entry
15481             CDS       T01002                                 

Gene name
Hspa8, 2410008N15Rik, Hsc70, Hsc71, Hsc73, Hsp73, Hspa10
Definition
(RefSeq) heat shock protein 8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu04010  MAPK signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04144  Endocytosis
mmu04213  Longevity regulating pathway - multiple species
mmu04612  Antigen processing and presentation
mmu04915  Estrogen signaling pathway
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    15481 (Hspa8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15481 (Hspa8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    15481 (Hspa8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15481 (Hspa8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    15481 (Hspa8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    15481 (Hspa8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    15481 (Hspa8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    15481 (Hspa8)
  09172 Infectious disease: viral
   05162 Measles
    15481 (Hspa8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15481 (Hspa8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    15481 (Hspa8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    15481 (Hspa8)
   03009 Ribosome biogenesis [BR:mmu03009]
    15481 (Hspa8)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15481 (Hspa8)
   04131 Membrane trafficking [BR:mmu04131]
    15481 (Hspa8)
   03051 Proteasome [BR:mmu03051]
    15481 (Hspa8)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15481 (Hspa8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15481 (Hspa8)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15481 (Hspa8)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19 complex
    15481 (Hspa8)
 Complex C
   Prp19-CDC5 complex
    15481 (Hspa8)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    15481 (Hspa8)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   15481 (Hspa8)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    15481 (Hspa8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    15481 (Hspa8)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15481 (Hspa8)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    15481 (Hspa8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15481 (Hspa8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 15481
NCBI-ProteinID: NP_112442
MGI: 105384
Ensembl: ENSMUSG00000015656
Vega: OTTMUSG00000030238
UniProt: P63017
Structure
PDB: 

Position
9 A5.1; 9 21.55 cM
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggcattgatctcggcaccacctactcctgtgtgggtgtc
ttccagcatggaaaggtggaaattattgccaatgaccagggtaaccgcaccacgccaagc
tatgttgctttcacggacacagagagattaattggggatgcggccaagaatcaggttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgatcgggcgtaggtttgatgat
gctgttgttcagtctgatatgaagcactggcccttcatggtggtgaatgatgcaggcagg
cccaaggtccaagtggaatacaaaggggagacaaaaagtttctacccagaggaagtgtcc
tccatggttctgacaaagatgaaggaaattgcagaagcgtacctcggaaagaccgttacc
aacgctgtggtcacagtgcccgcttacttcaatgactctcagcgacaggcaacaaaagat
gctggaactattgctggcctcaatgtacttcgaatcatcaatgaaccaactgctgctgct
attgcttacggcttagataagaaggtcggagctgaaaggaatgtgctcatttttgacttg
ggaggtggcacttttgatgtgtcaatcctcactattgaggatggaatttttgaggtcaaa
tcaacagctggagacacccacttaggtggagaagattttgacaaccgaatggtcaatcat
ttcattgctgagttcaagcgaaagcacaagaaagacatcagtgagaacaagagagctgtc
cgccgtctccgcacggcctgcgagcgggccaagcgcaccctctcctccagcacccaggcc
agtattgagattgattctctctatgagggaattgacttctatacctccattacccgggct
cgatttgaggagttgaatgctgacctgttccgtggcacactggaccctgtagagaaggcc
cttcgagatgccaagctggacaagtcacagatccatgatattgtcttggtgggtggttct
accagaatccccaagattcagaaacttctgcaagacttcttcaatggaaaagagctgaac
aagagcattaaccccgatgaagctgttgcctatggtgcagctgtccaggcagccattcta
tctggagacaagtctgagaacgttcaggatttgctgctcttggatgtcactcctctttcc
cttggtattgaaactgctggcggagtcatgactgtcctcatcaagcgcaataccaccatc
cccaccaagcagacacagactttcaccacctactctgacaaccagcctggtgtactcatt
caggtgtatgaaggtgaaagggccatgaccaaggacaacaacctgcttggaaagttcgag
ctcacaggcatccctccagcaccccgtggggtccctcagattgaggttacttttgacatc
gatgccaatggcatcctcaatgtttctgctgtagataagagcacaggaaaggagaacaag
atcaccatcaccaatgacaagggccgcttgagtaaggaagatattgagcgcatggtccaa
gaagctgagaagtacaaggctgaggatgagaagcagagagataaggtttcctccaagaac
tcactggagtcctatgccttcaacatgaaagcaactgtggaagatgagaaacttcaaggc
aagatcaatgatgaggacaaacagaagattcttgacaagtgcaatgaaatcatcagctgg
ctggataagaaccagactgcagagaaggaagaatttgagcatcagcagaaagaactggag
aaagtctgcaaccctatcattaccaagctgtaccagagtgcaggtggcatgcctggggga
atgcctggtggcttcccaggtggaggagctcccccatctggtggtgcttcttcaggcccc
accattgaagaggtggattaa

KEGG   Mus musculus (mouse): 15482Help
Entry
15482             CDS       T01002                                 

Gene name
Hspa1l, Hsc70t, Msh5
Definition
(RefSeq) heat shock protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu04010  MAPK signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04144  Endocytosis
mmu04213  Longevity regulating pathway - multiple species
mmu04612  Antigen processing and presentation
mmu04915  Estrogen signaling pathway
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    15482 (Hspa1l)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15482 (Hspa1l)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    15482 (Hspa1l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15482 (Hspa1l)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    15482 (Hspa1l)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    15482 (Hspa1l)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    15482 (Hspa1l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    15482 (Hspa1l)
  09172 Infectious disease: viral
   05162 Measles
    15482 (Hspa1l)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15482 (Hspa1l)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    15482 (Hspa1l)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    15482 (Hspa1l)
   03009 Ribosome biogenesis [BR:mmu03009]
    15482 (Hspa1l)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15482 (Hspa1l)
   04131 Membrane trafficking [BR:mmu04131]
    15482 (Hspa1l)
   03051 Proteasome [BR:mmu03051]
    15482 (Hspa1l)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15482 (Hspa1l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15482 (Hspa1l)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15482 (Hspa1l)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19 complex
    15482 (Hspa1l)
 Complex C
   Prp19-CDC5 complex
    15482 (Hspa1l)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    15482 (Hspa1l)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   15482 (Hspa1l)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    15482 (Hspa1l)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    15482 (Hspa1l)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15482 (Hspa1l)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    15482 (Hspa1l)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15482 (Hspa1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C DUF1464
Motif
Other DBs
NCBI-GeneID: 15482
NCBI-ProteinID: NP_038586
MGI: 96231
Ensembl: ENSMUSG00000007033
Vega: OTTMUSG00000016296
UniProt: P16627 A1L347
Position
17 B1; 17 18.51 cM
AA seq 641 aa AA seqDB search
MAANKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAA
KNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKE
LENMCNPIITKLYQSGCTGPTCTPGYTPGRAATGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaataaaggaatggcgatcggcatcgacttgggcaccacctactcgtgcgtg
ggcgtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacc
cctagctacgtggccttcaccgacaccgagcgcctcatcggagacgctgccaagaaccag
gtggccatgaatccccagaacactgtttttgatgccaaacgtctaattggcaggaagttt
aatgatcctgttgtgcagtcagatatgaagctttggccatttcaagtgatcaatgaagcc
ggcaaacccaaggtgatggtgtcctataaaggagagaagaaagccttctacccagaggag
atctcatccatggtactgacgaagatgaaggagactgcagaggcttttttgggccacaat
gtcaccaacgctgtgatcacggtgccagcctatttcaatgactctcagcggcaagccacc
aaggatgcaggtgtcatcgcaggactcaatgtgctgagaataatcaatgagcccacggcg
gccgccatcgcctacggcttggataaaggaagtcacggagagcggcacgtgctcatcttc
gacctggggggtggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgag
gtgaaggccacggcgggcgacacgcacctgggaggggaggacttcgacaaccggctggtg
agccacttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgc
gcggtgcggcggctgcgcactgcgtgtgagagggccaagaggacgctgtcgtccagcacc
caggcaaacctggagatcgactctttatatgagggcatcgacttctacacgtccatcact
agagcacggtttgaagagctgtgtgcagacctatttagaggcacacttgagcccgtggaa
aagtctcttcgggatgccaagatggataaggctaaaatccatgacattgttctagtaggg
ggctccacccgcatcccaaaggtgcaaaaactgcttcaggactactttaatggacgggat
ctcaacaagagtatcaatcccgatgaggcagtcgcctacggagctgcagtccaggcagct
attttaatgggcgacaaatctgaaaaagtacaggatttgcttttgttggacgtagctccc
ctgtctctaggattggagacagctgggggtgtgatgactgtactgatcaagcgcaactcc
accatccccaccaagcagacgcagatcttcaccacctactcggacaaccagcccggggtg
ctgatccaggtgtacgagggcgagagagccatgacgcgcgacaacaacctgctggggcgc
tttgacttgactggaatacctcctgcacctaggggcgtgccacagatcgaggtgaccttc
gacatcgacgccaacggtatcctgaacgtcacggccatggacaagagcaccggcaaggcc
aacaagatcaccatcaccaacgacaagggtcgcctgagcaaggaggagattgagcgcatg
gtgcaggaggccgagcgctacaaagcggaggatgagggccagagggagaaaatcgctgcc
aaaaatgccttagaatcgtacgcctttaatatgaagagcgctgtgggtgatgagggtctg
aaggacaagatcagcgagtccgataaaaagaaaatactggataaatgcaatgaggtcctt
tcctggctggaggccaaccagctggctgagaaagatgagtttgatcataaaagaaaagaa
ctggaaaatatgtgtaatccgatcatcacaaaactgtaccagagcggatgcaccgggccc
acctgtacgccagggtatactcccggcagggctgccacaggccctaccatcgaggaagta
gattag

KEGG   Mus musculus (mouse): 15511Help
Entry
15511             CDS       T01002                                 

Gene name
Hspa1b, HSP70B1, Hsp70, Hsp70-1, Hsp70.1, hsp68
Definition
(RefSeq) heat shock protein 1B
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu04010  MAPK signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04144  Endocytosis
mmu04213  Longevity regulating pathway - multiple species
mmu04612  Antigen processing and presentation
mmu04915  Estrogen signaling pathway
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    15511 (Hspa1b)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15511 (Hspa1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    15511 (Hspa1b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15511 (Hspa1b)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    15511 (Hspa1b)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    15511 (Hspa1b)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    15511 (Hspa1b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    15511 (Hspa1b)
  09172 Infectious disease: viral
   05162 Measles
    15511 (Hspa1b)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15511 (Hspa1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    15511 (Hspa1b)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    15511 (Hspa1b)
   03009 Ribosome biogenesis [BR:mmu03009]
    15511 (Hspa1b)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15511 (Hspa1b)
   04131 Membrane trafficking [BR:mmu04131]
    15511 (Hspa1b)
   03051 Proteasome [BR:mmu03051]
    15511 (Hspa1b)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15511 (Hspa1b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15511 (Hspa1b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15511 (Hspa1b)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19 complex
    15511 (Hspa1b)
 Complex C
   Prp19-CDC5 complex
    15511 (Hspa1b)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    15511 (Hspa1b)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   15511 (Hspa1b)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    15511 (Hspa1b)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    15511 (Hspa1b)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15511 (Hspa1b)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    15511 (Hspa1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15511 (Hspa1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Radial_spoke_3 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 15511
NCBI-ProteinID: NP_034608
MGI: 99517
Ensembl: ENSMUSG00000090877
Vega: OTTMUSG00000037920
UniProt: P17879
Position
17 B1; 17 18.5 cM
AA seq 642 aa AA seqDB search
MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEIS
SMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKN
ALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKREELE
RVCSPIISGLYQGAGAPGAGGFGAQAPPKGASGSGPTIEEVD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaacacggcgatcggcatcgacctgggcaccacctactcgtgcgtgggcgtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacccccagc
tacgtggccttcaccgacaccgagcgcctcatcggggacgccgccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgcgaagcggctgatcggccgcaagttcggcgat
gcggtggtgcagtccgacatgaagcactggcccttccaggtggtgaacgacggcgacaag
cccaaggtgcaggtgaactacaagggcgagagccggtcgttcttcccggaggagatctcg
tccatggtgctgacgaagatgaaggagatcgctgaggcgtacctgggccacccggtgacc
aacgcggtgatcacggtgcccgcctacttcaacgactctcagcggcaggccaccaaggac
gcgggcgtgatcgccggtctaaacgtgctgcggatcatcaacgagcccacggcggccgcc
atcgcctacgggctggaccggaccggcaagggcgagcgcaacgtgctcatcttcgacctg
gggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggcgggcgacacgcacctgggaggggaggacttcgacaaccggctggtgagccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgcgcggtg
cggcggctgcgcacggcgtgtgagagggccaagaggacgctgtcgtccagcacccaggcc
agcctggagatcgactctctgttcgagggcatcgacttctacacatccatcacgcgggcg
cggttcgaagagctgtgctcggacctgttccgcggcacgctggagcccgtggagaaggcc
ctgcgcgacgccaagatggacaaggcgcagatccacgacctggtgctggtgggcggctcg
acgcgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaacccggacgaggcggtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtcggagaacgtgcaggacctgctgctgctggacgtggcgccgctgtcg
ctgggcctggagactgcgggcggcgtgatgacggcgctcatcaagcgcaactccaccatc
cccaccaagcagacgcagaccttcaccacctactcggacaaccagcccggggtgctgatc
caggtgtacgagggcgagagggccatgacgcgcgacaacaacctgctggggcgcttcgag
ctgagcggcatcccgccggcgcccaggggcgtgccgcagatcgaggtgaccttcgacatc
gacgccaacggcatcctgaacgtcacggccaccgacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagcgctacaaggccgaggacgaggtgcagcgcgacagggtggccgccaagaac
gcgctcgagtcctatgccttcaacatgaagagcgccgtggaggacgagggtctcaagggc
aagctcagcgaggctgacaagaagaaggtgctggacaagtgccaggaggtcatctcctgg
ctggactccaacacgctggccgacaaggaggagttcgtgcacaagcgggaggagctggag
cgggtgtgcagccccatcatcagtgggctgtaccagggtgcgggtgctcctggggctggg
ggcttcggggcccaggcgccgccgaaaggagcctctggctcaggacccaccatcgaggag
gtggattag

KEGG   Mus musculus (mouse): 15512Help
Entry
15512             CDS       T01002                                 

Gene name
Hspa2, 70kDa, HSP70.2, HSP70A2, Hsp70-2
Definition
(RefSeq) heat shock protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu04010  MAPK signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04144  Endocytosis
mmu04213  Longevity regulating pathway - multiple species
mmu04612  Antigen processing and presentation
mmu04915  Estrogen signaling pathway
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    15512 (Hspa2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15512 (Hspa2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    15512 (Hspa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15512 (Hspa2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    15512 (Hspa2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    15512 (Hspa2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    15512 (Hspa2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    15512 (Hspa2)
  09172 Infectious disease: viral
   05162 Measles
    15512 (Hspa2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15512 (Hspa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    15512 (Hspa2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    15512 (Hspa2)
   03009 Ribosome biogenesis [BR:mmu03009]
    15512 (Hspa2)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15512 (Hspa2)
   04131 Membrane trafficking [BR:mmu04131]
    15512 (Hspa2)
   03051 Proteasome [BR:mmu03051]
    15512 (Hspa2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15512 (Hspa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15512 (Hspa2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15512 (Hspa2)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19 complex
    15512 (Hspa2)
 Complex C
   Prp19-CDC5 complex
    15512 (Hspa2)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    15512 (Hspa2)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   15512 (Hspa2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    15512 (Hspa2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    15512 (Hspa2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15512 (Hspa2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    15512 (Hspa2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15512 (Hspa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG DUF1464 DDR Hydantoinase_A CRIC_ras_sig Zincin_2
Motif
Other DBs
NCBI-GeneID: 15512
NCBI-ProteinID: NP_001002012
MGI: 96243
Ensembl: ENSMUSG00000059970
UniProt: P17156
Position
12 C3; 12 33.73 cM
AA seq 633 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGSSGGPTIEEVD
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgcggcccggctatcggcatcgacctgggcaccacttactcgtgcgtgggg
gtattccaacatggcaaggtggagatcatcgccaacgaccagggtaaccgcaccaccccc
agctacgtggccttcactgacaccgagcgtctcatcggcgacgccgccaagaaccaagtg
gccatgaaccccacaaacaccatcttcgacgccaagcggctgatcggacggaagttcgag
gacgccacagtgcagtccgatatgaagcactggccgttccgagtggtgagcgaaggtggg
aagcccaaagtgcaggtggaatataaaggggagatgaagaccttcttccctgaggagatt
tcttccatggtcctcactaagatgaaggagatcgccgaagcctacctggggggcaaggtg
cagagcgcagtcatcactgttcctgcctatttcaacgactcgcagcgccaggccaccaag
gatgcgggcaccatcaccggcctcaacgtgttgcgcatcatcaatgagcccacagcagcg
gccatcgcctacggcctggataagaagggctgtgcgggcggcgagaagaacgtgctcatc
tttgacctgggcgggggcaccttcgatgtgtccatcctgaccatcgaggatggcatcttt
gaggtgaagtccacggccggcgatacccacctgggtggcgaagacttcgacaaccgtatg
gtcagccacctggcggaggagttcaagcgcaaacacaagaaggacattgggcccaacaag
cgcgctgtgcgccggctgcgcaccgcctgcgagcgcgctaagcgcaccctgagctcgtcc
acgcaggccagcatagagatcgactcgctctacgagggcgtggatttctacacgtccatc
acccgcgcccgcttcgaggagctcaacgccgatctcttccgagggaccctggagccggtg
gaaaaggcgctgcgcgatgccaagctagacaagggccagatccaggagatagtgctggtg
ggcggctcaacccgcatccctaagatccagaagctcctgcaagatttcttcaacggcaag
gagctgaacaagagcattaatcccgacgaggcggtggcctacggcgccgctgtgcaggcg
gctatcctcatcggcgacaagtcggaaaatgtgcaggatctgctgttactcgacgtgact
ccattgtcgctcggcatcgaaacagctggcggtgtcatgaccccactcatcaagagaaac
accacgatccccaccaagcagacgcagaccttcactacctactcagacaaccagagcagc
gtgctggtgcaagtgtacgagggcgaacgggccatgaccaaggacaataacctcttgggc
aagttcgacctgactgggatccccccagcaccccgtggggtcccccagatcgaggtcacc
tttgacatcgatgccaacggcatccttaacgtcactgctgccgacaagagcaccggtaaa
gaaaataaaatcaccataaccaacgacaagggtcggctgagcaaagacgacattgaccgg
atggtgcaggaggcggagcggtacaaatcggaagatgaagcaaatcgcgatcgcgtggca
gccaaaaatgcggtggagtcctatacctacaacatcaagcagaccgtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggcttgaccgaaaccagatggcagagaaagatgagtacgaacacaagcagaaa
gagcttgagagagtgtgcaaccccatcatcagcaaactttaccaaggcggtccaggcggc
ggcggctcctctggagggcccaccatcgaggaagtggactag

KEGG   Mus musculus (mouse): 193740Help
Entry
193740            CDS       T01002                                 

Gene name
Hspa1a, Hsp70-3, Hsp70.3, Hsp72, hsp68, hsp70A1
Definition
(RefSeq) heat shock protein 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu04010  MAPK signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04144  Endocytosis
mmu04213  Longevity regulating pathway - multiple species
mmu04612  Antigen processing and presentation
mmu04915  Estrogen signaling pathway
mmu05020  Prion diseases
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    193740 (Hspa1a)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    193740 (Hspa1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    193740 (Hspa1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    193740 (Hspa1a)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    193740 (Hspa1a)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    193740 (Hspa1a)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    193740 (Hspa1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion diseases
    193740 (Hspa1a)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    193740 (Hspa1a)
  09172 Infectious disease: viral
   05162 Measles
    193740 (Hspa1a)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    193740 (Hspa1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    193740 (Hspa1a)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    193740 (Hspa1a)
   03009 Ribosome biogenesis [BR:mmu03009]
    193740 (Hspa1a)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    193740 (Hspa1a)
   04131 Membrane trafficking [BR:mmu04131]
    193740 (Hspa1a)
   03051 Proteasome [BR:mmu03051]
    193740 (Hspa1a)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    193740 (Hspa1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    193740 (Hspa1a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     193740 (Hspa1a)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19 complex
    193740 (Hspa1a)
 Complex C
   Prp19-CDC5 complex
    193740 (Hspa1a)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    193740 (Hspa1a)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   193740 (Hspa1a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    193740 (Hspa1a)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    193740 (Hspa1a)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    193740 (Hspa1a)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    193740 (Hspa1a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   193740 (Hspa1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Radial_spoke_3 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 193740
NCBI-ProteinID: NP_034609
MGI: 96244
Ensembl: ENSMUSG00000091971
Vega: OTTMUSG00000037921
UniProt: Q61696 Q3TU85
Position
17 B1; 17 18.51 cM
AA seq 641 aa AA seqDB search
MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEIS
SMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKN
ALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKREELE
RVCSPIISGLYQGAGAPGAGGFGAQAPKGASGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaacacggcgatcggcatcgacctgggcaccacctactcgtgcgtgggcgtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacccccagc
tacgtggccttcaccgacaccgagcgcctcatcggagacgccgccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgcgaagcggctgatcggccgcaagttcggcgat
gcggtggtgcagtccgacatgaagcactggcccttccaggtggtgaacgacggcgacaag
cccaaggtgcaggtgaactacaagggcgagagccggtcgttcttcccggaggagatctcg
tccatggtgctgacgaagatgaaggagatcgctgaggcgtacctgggccacccggtgacc
aacgcggtgatcacggtgcccgcctacttcaacgactctcagcggcaggccaccaaggac
gcgggcgtgatcgccggtctaaacgtgctgcggatcatcaacgagcccacggcggccgcc
atcgcctacgggctggaccggaccggcaagggcgagcgcaacgtgctcatcttcgacctg
gggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggcgggcgacacgcacctgggaggggaggacttcgacaaccggctggtgagccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgcgcggtg
cggcggctgcgcactgcgtgtgagagggccaagaggacgctgtcgtccagcacccaggcc
agcctggagatcgactctctgttcgagggcatcgacttctacacatccatcacgcgggcg
cggttcgaagagctgtgctcagacctgttccgcggcacgctggagcccgtggagaaggcc
ctgcgcgacgccaagatggacaaggcgcagatccacgacctggtgctggtgggcggctcg
acgcgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaacccggacgaggcggtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtcggagaacgtgcaggacctgctgctgctggacgtggcgccgctgtcg
ctgggcctggagactgcgggcggcgtgatgacggcgctcatcaagcgcaactccaccatc
cccaccaagcagacgcagaccttcaccacctactcggacaaccagcccggggtgctgatc
caggtgtacgagggcgagagggccatgacgcgcgacaacaacctgctggggcgcttcgaa
ctgagcggcatcccgccggcgcccaggggcgtgccacagatcgaggtgaccttcgacatc
gacgccaacggcatcctgaacgtcacggccaccgacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagcgctacaaggccgaggacgaggtgcagcgcgacagggtggccgccaagaac
gcgctcgaatcctatgccttcaacatgaagagcgccgtggaggacgagggtctcaagggc
aagctcagcgaggctgacaagaagaaggtgctggacaagtgccaggaggtcatctcctgg
ctggactccaacacgctggccgacaaggaggagttcgtgcacaagcgggaggagctggag
cgggtgtgcagccccatcatcagtgggctgtaccagggtgcgggtgctcctggggctggg
ggcttcggggcccaggcgcccaagggagcctctggctcaggacccaccatcgaggaggtg
gattag

DBGET integrated database retrieval system