KEGG   Mus musculus (mouse): 15482
Entry
15482             CDS       T01002                                 

Gene name
Hspa1l, 70kD, Hsc70, Hsc70t, Msh, Msh5
Definition
(RefSeq) heat shock protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03040  Spliceosome
mmu04010  MAPK signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04144  Endocytosis
mmu04213  Longevity regulating pathway - multiple species
mmu04612  Antigen processing and presentation
mmu04915  Estrogen signaling pathway
mmu05020  Prion disease
mmu05134  Legionellosis
mmu05145  Toxoplasmosis
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    15482 (Hspa1l)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15482 (Hspa1l)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    15482 (Hspa1l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15482 (Hspa1l)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    15482 (Hspa1l)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    15482 (Hspa1l)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    15482 (Hspa1l)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    15482 (Hspa1l)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    15482 (Hspa1l)
  09172 Infectious disease: viral
   05162 Measles
    15482 (Hspa1l)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15482 (Hspa1l)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    15482 (Hspa1l)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    15482 (Hspa1l)
   03009 Ribosome biogenesis [BR:mmu03009]
    15482 (Hspa1l)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15482 (Hspa1l)
   04131 Membrane trafficking [BR:mmu04131]
    15482 (Hspa1l)
   03051 Proteasome [BR:mmu03051]
    15482 (Hspa1l)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15482 (Hspa1l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15482 (Hspa1l)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15482 (Hspa1l)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19 complex
    15482 (Hspa1l)
 Complex C
   Prp19-CDC5 complex
    15482 (Hspa1l)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    15482 (Hspa1l)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   15482 (Hspa1l)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    15482 (Hspa1l)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    15482 (Hspa1l)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15482 (Hspa1l)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    15482 (Hspa1l)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15482 (Hspa1l)
SSDB
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C DUF1464
Other DBs
NCBI-GeneID: 15482
NCBI-ProteinID: NP_038586
MGI: 96231
Ensembl: ENSMUSG00000007033
Vega: OTTMUSG00000016296
UniProt: P16627 A1L347
Position
17 B1; 17 18.51 cM
AA seq 641 aa
MAANKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAA
KNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKE
LENMCNPIITKLYQSGCTGPTCTPGYTPGRAATGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggctgctaataaaggaatggcgatcggcatcgacttgggcaccacctactcgtgcgtg
ggcgtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacc
cctagctacgtggccttcaccgacaccgagcgcctcatcggagacgctgccaagaaccag
gtggccatgaatccccagaacactgtttttgatgccaaacgtctaattggcaggaagttt
aatgatcctgttgtgcagtcagatatgaagctttggccatttcaagtgatcaatgaagcc
ggcaaacccaaggtgatggtgtcctataaaggagagaagaaagccttctacccagaggag
atctcatccatggtactgacgaagatgaaggagactgcagaggcttttttgggccacaat
gtcaccaacgctgtgatcacggtgccagcctatttcaatgactctcagcggcaagccacc
aaggatgcaggtgtcatcgcaggactcaatgtgctgagaataatcaatgagcccacggcg
gccgccatcgcctacggcttggataaaggaagtcacggagagcggcacgtgctcatcttc
gacctggggggtggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgag
gtgaaggccacggcgggcgacacgcacctgggaggggaggacttcgacaaccggctggtg
agccacttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgc
gcggtgcggcggctgcgcactgcgtgtgagagggccaagaggacgctgtcgtccagcacc
caggcaaacctggagatcgactctttatatgagggcatcgacttctacacgtccatcact
agagcacggtttgaagagctgtgtgcagacctatttagaggcacacttgagcccgtggaa
aagtctcttcgggatgccaagatggataaggctaaaatccatgacattgttctagtaggg
ggctccacccgcatcccaaaggtgcaaaaactgcttcaggactactttaatggacgggat
ctcaacaagagtatcaatcccgatgaggcagtcgcctacggagctgcagtccaggcagct
attttaatgggcgacaaatctgaaaaagtacaggatttgcttttgttggacgtagctccc
ctgtctctaggattggagacagctgggggtgtgatgactgtactgatcaagcgcaactcc
accatccccaccaagcagacgcagatcttcaccacctactcggacaaccagcccggggtg
ctgatccaggtgtacgagggcgagagagccatgacgcgcgacaacaacctgctggggcgc
tttgacttgactggaatacctcctgcacctaggggcgtgccacagatcgaggtgaccttc
gacatcgacgccaacggtatcctgaacgtcacggccatggacaagagcaccggcaaggcc
aacaagatcaccatcaccaacgacaagggtcgcctgagcaaggaggagattgagcgcatg
gtgcaggaggccgagcgctacaaagcggaggatgagggccagagggagaaaatcgctgcc
aaaaatgccttagaatcgtacgcctttaatatgaagagcgctgtgggtgatgagggtctg
aaggacaagatcagcgagtccgataaaaagaaaatactggataaatgcaatgaggtcctt
tcctggctggaggccaaccagctggctgagaaagatgagtttgatcataaaagaaaagaa
ctggaaaatatgtgtaatccgatcatcacaaaactgtaccagagcggatgcaccgggccc
acctgtacgccagggtatactcccggcagggctgccacaggccctaccatcgaggaagta
gattag

DBGET integrated database retrieval system