KEGG   Mus musculus (mouse): 15484Help
Entry
15484             CDS       T01002                                 

Gene name
Hsd11b2, 11HSD2
Definition
(RefSeq) hydroxysteroid 11-beta dehydrogenase 2
  KO
K00071  corticosteroid 11-beta-dehydrogenase isozyme 2 [EC:1.1.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu04960  Aldosterone-regulated sodium reabsorption
Module
mmu_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    15484 (Hsd11b2)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    15484 (Hsd11b2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     15484 (Hsd11b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Motif
Other DBs
NCBI-GeneID: 15484
NCBI-ProteinID: NP_032315
MGI: 104720
Ensembl: ENSMUSG00000031891
Vega: OTTMUSG00000062049
UniProt: P51661 Q6NZB9
Position
8 D3; 8 53.04 cM
AA seq 386 aa AA seqDB search
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALVV
LAGAGWIALSRLARPPRLPVATRAVLITGCDTGFGKETAKKLDAMGFTVLATVLDLNSPG
ALELRDLCSPRLKLLQMDLTKAEDISRVLEITKAHTASTGLWGLVNNAGLNIVVADVELS
PVATFRKCMEVNFFGALELTKGLLPLLRHSRGRIVTVGSPAGDMPYPCLAAYGTSKAAIA
LLMDTFGCELLPWGIKVSIIKPGCFKTDAVTNVNLWEKRKQLLLANIPRELLQAYGEDYI
EHVHGQFLNSLRMALPDLSPVVDAIIDALLAAQPRSRYYPGRGLGLMYFIHHYLPEGLRR
CFLQNFFINHLLPRALRPGQHGPAPA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctggccttggccgtcgggcggcgcctggctgctggtggctgcccgcgcgctg
ctgcagctgctgcgctcagacctgcgtctgggccgcccgttgttggcggcactggccctg
ctggctgctctcgactggctgtgccagcgcctgctgcccccgccggcggcactcgtggtg
ctggctggtgctggctggatcgcgttgtcccgcctagcgcgccctcctcgcctgccggtg
gccactcgcgcggtgctcatcaccggttgtgacactggttttggcaaggagacagctaag
aaactggatgccatgggcttcacggtgctggccacagtgttggatttgaatagccctggt
gccctagaactgcgtgacctctgttctcctcgcctgaagctgctgcagatggatctgacc
aaggcagaggacatcagccgtgttctggaaatcaccaaggcccacacggccagcactggc
ctgtggggtctggttaacaacgctggcctcaatatcgtagtggctgacgtggaactgtct
ccagtggcgactttccgcaagtgcatggaggtgaacttctttggtgcacttgagctgacc
aagggcctcctgccactcttgcgtcactcgaggggacgtattgtgaccgttggcagccca
gcaggagacatgccatacccctgcttggcagcctacggcacctccaaggcagcaatagca
ctgcttatggacacattcggctgtgagctgcttccctggggtatcaaggtcagcattatc
aagcctggctgcttcaagacagatgcagtgactaatgtgaacctctgggagaaacgcaag
caactgctgctggccaacattcctagagagctgctccaggcctatggtgaagactacatt
gagcacgtgcacgggcagttcctgaattcactcagaatggcattgcctgaccttagccca
gttgtagatgccatcatcgatgcattgctggcagctcagccacgaagccgctactaccca
ggccgtggcctggggctcatgtatttcatccaccactacctgccagagggcctgcgacgc
tgcttcctacagaacttctttatcaatcaccttctgccccgagcactgaggcccggccaa
catggccctgctcctgcttaa

DBGET integrated database retrieval system