KEGG   Mus musculus (mouse): 15493Help
Entry
15493             CDS       T01002                                 

Gene name
Hsd3b2, 3-beta-HSD_II
Definition
(RefSeq) hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu01100  Metabolic pathways
mmu04913  Ovarian steroidogenesis
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
Module
mmu_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
mmu_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    15493 (Hsd3b2)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    15493 (Hsd3b2)
   04925 Aldosterone synthesis and secretion
    15493 (Hsd3b2)
   04927 Cortisol synthesis and secretion
    15493 (Hsd3b2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    15493 (Hsd3b2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     15493 (Hsd3b2)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     15493 (Hsd3b2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 NmrA KR RmlD_sub_bind Ldh_1_N Sacchrp_dh_NADP Ufm1
Motif
Other DBs
NCBI-GeneID: 15493
NCBI-ProteinID: NP_694873
MGI: 96234
Ensembl: ENSMUSG00000063730
Vega: OTTMUSG00000006735
UniProt: P26149
Position
3 F2.2; 3 42.85 cM
AA seq 373 aa AA seqDB search
MPGWSCLVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFRPETRKEFFNLETSIKVTVLE
GDILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAF
IFSSSVDVAGPNSYKEIVLNGHEEECHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTL
QTCALRPMCIYGERSPLISNIIIMALKHKGILRSFGKFNTANPVYVGNVAWAHILAARGL
RDPKKSPNIQGEFYYISDDTPHQSFDDISYTLSKEWGFCLDSSWSLPVPLLYWLAFLLET
VSFLLSPIYRYIPPFNRHLVTLSGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTL
VEQHRETLDTKSQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggtggagctgcctggtgactggagcaggagggtttttggggcagaggatcatc
cagttgttggtgcaagaggaagatctggaggagatcagggtcctggacaaggtcttcaga
ccagaaacaaggaaggaattcttcaacctagagacaagcatcaaggtgacagtgttggaa
ggagacattcttgacacccagtacctgaggagagcttgccagggcatctctgttgtcatc
catactgctgccatcattgatgtcacaggtgtcattcccaggcagaccatcctagatgtc
aatctgaaaggtacccagaacttattggaggcctgtatccaagccagtgtgccagccttc
atcttctccagctcagttgatgttgcagggcccaactcttacaaggagattgtcttgaat
ggccatgaggaagagtgtcatgaaagtacatggtctgatccatacccatacagcaaaaag
atggctgagaaggcagtgctggcagccaatgggagcatgctgaaaaatggtggcactttg
caaacttgtgcattaaggcccatgtgcatttatggggagagaagtccactcatttctaac
ataataattatggcccttaaacataagggtattctgagaagttttggcaaattcaacaca
gccaacccagtatatgtgggcaatgtagcctgggcacacattctggctgccaggggcctt
cgagaccccaagaagtcaccaaatatccaaggagagttctactacatctcagatgacacc
cctcaccaaagctttgatgatataagttacaccttgagcaaggagtggggcttctgcctt
gattccagctggagccttcctgtgcccctactgtactggcttgcattcctgctggaaact
gtgagcttcctcctgagtccaatctacagatatatacctccctttaaccgccacttggtc
acactgtcaggtagcacattcactttctcctacaagaaagctcagcgagatctgggctat
gagccacttgtcagctgggaggaagccaagcagaaaacctcagagtggatcgggacacta
gtggagcagcacagggagacactggacacaaagtctcagtga

DBGET integrated database retrieval system