KEGG   Mus musculus (mouse): 15499
Entry
15499             CDS       T01002                                 

Gene name
Hsf1, AA960185, HSTF, HSTF_1, Hsf1alpha, Hsf1beta
Definition
(RefSeq) heat shock factor 1
  KO
K09414  heat shock transcription factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    15499 (Hsf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15499 (Hsf1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Heat shock factors
    15499 (Hsf1)
SSDB
Motif
Pfam: Vert_HS_TF HSF_DNA-bind ZapB Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 15499
NCBI-ProteinID: NP_001318083
MGI: 96238
Ensembl: ENSMUSG00000022556
UniProt: P38532 A0A075F891
Position
15 D3; 15 35.95 cM
AA seq 525 aa
MDLAVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTRLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLSDSNSAHSVPKYGRQYSLEHVHGPGPY
SAPSPAYSSSSLYSSDAVTSSGPIISDITELAPTSPLASPGRSIDERPLSSSTLVRVKQE
PPSPPHSPRVLEASPGRPSSMDTPLSPTAFIDSILRESEPTPAASNTAPMDTTGAQAPAL
PTPSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLTSHGFSVDTSALLDLFSPSVTM
PDMSLPDLDSSLASIQELLSPQEPPRPIEAENSNPDSGKQLVHYTAQPLFLLDPDAVDTG
SSELPVLFELGESSYFSEGDDYTDDPTISLLTGTEPHKAKDPTVS
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggatctggccgtgggccccggtgcagcggggcccagcaacgtcccggccttcctaacc
aagctgtggaccctcgtgagcgacccggacacagacgcgctcatctgctggagcccgagt
gggaacagcttccacgtgtttgaccagggccagtttgccaaggaggtgctgcccaagtac
ttcaagcacaacaacatggctagcttcgtgcggcagctcaacatgtatggcttccgaaaa
gtagtccacattgagcagggtggcctggtcaagcctgagagagatgacaccgagttccag
catccttgtttcttgcgtggacaggaacagctccttgagaacatcaagaggaaagtgacc
agcgtgtccaccctgaagagtgaggacataaaaatacgccaggacagtgtcacccggctg
ttgacagatgtgcagctgatgaaggggaaacaggagtgtatggactccaagctcctggcc
atgaagcacgagaacgaggccctgtggcgggaggtggccagccttcggcagaagcatgcc
cagcagcaaaaagttgtcaacaagctcattcagttcctgatctcactggtgcagtcgaac
cggatcctgggggtgaagagaaagatccctctgatgttgagtgacagcaactcagcacac
tctgtgcccaagtatggtcgacagtactccctggagcatgtccatggtcctggcccatac
tcagctccatctccagcctacagcagctctagcctttactcctctgatgctgtcaccagc
tctggacccataatctccgatatcactgagctggctcccaccagccctttggcctcccca
ggcaggagcatagatgagaggcctctgtccagcagcactctggtccgtgtcaagcaagag
ccccccagcccacctcacagccctcgggtactggaggcgagccctgggcgcccatcctcc
atggatacccctttgtccccaactgccttcattgactccatccttcgagagagcgagcct
acccctgctgcctcaaacacagcccctatggacacaaccggagcccaagcccccgcactc
ccgaccccctccacccctgagaagtgcctcagcgtagcctgcctagacaagaacgagcta
agtgatcacctggatgccatggactccaacctggacaacctgcagaccatgctgacaagc
cacggcttcagtgtggacaccagtgccctgctggacctgttcagcccctcggtgaccatg
cccgacatgagcctgcctgacctggacagcagcctggccagcattcaggagcttctgtct
ccacaagagcctcccaggcctattgaggcagagaacagtaaccccgactcaggaaagcag
ctggtgcactacacggctcagcctctgttcctgctggatcctgatgctgtggacacaggg
agcagtgagctgcctgtgctctttgagctgggggagagctcctacttctctgagggggat
gactacacggatgatcccaccatctctcttctgacaggcactgaaccccataaagccaag
gaccccactgtctcctag

DBGET integrated database retrieval system