KEGG   Mus musculus (mouse): 15516
Entry
15516             CDS       T01002                                 

Gene name
Hsp90ab1, 90kDa, AL022974, C81438, Hsp, Hsp84, Hsp84-1, Hsp90, Hspcb
Definition
(RefSeq) heat shock protein 90 alpha (cytosolic), class B member 1
  KO
K04079  molecular chaperone HtpG
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04612  Antigen processing and presentation
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04659  Th17 cell differentiation
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu05132  Salmonella infection
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15516 (Hsp90ab1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    15516 (Hsp90ab1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15516 (Hsp90ab1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    15516 (Hsp90ab1)
   04612 Antigen processing and presentation
    15516 (Hsp90ab1)
   04659 Th17 cell differentiation
    15516 (Hsp90ab1)
   04657 IL-17 signaling pathway
    15516 (Hsp90ab1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    15516 (Hsp90ab1)
   04914 Progesterone-mediated oocyte maturation
    15516 (Hsp90ab1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15516 (Hsp90ab1)
  09162 Cancer: specific types
   05215 Prostate cancer
    15516 (Hsp90ab1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    15516 (Hsp90ab1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    15516 (Hsp90ab1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15516 (Hsp90ab1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP90
   15516 (Hsp90ab1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    15516 (Hsp90ab1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15516 (Hsp90ab1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    15516 (Hsp90ab1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15516 (Hsp90ab1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 15516
NCBI-ProteinID: NP_032328
MGI: 96247
Ensembl: ENSMUSG00000023944
Vega: OTTMUSG00000020123
UniProt: P11499 Q71LX8
Position
17 B3; 17 22.59 cM
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacctttgcctttcaggcagaa
attgcccagctcatgtccctcatcatcaacactttctattcaaacaaggagattttcctc
cgcgagttgatctctaatgcttcagatgccctggacaagattcgatatgagagcctgacg
gacccttctaagttggacagtgggaaagagctgaaaattgacatcatccccaaccctcag
gagcgcacgctgactttggtggacacaggcattggcatgaccaaggctgacctcattaat
aacctgggaaccattgctaagtctggcacgaaggcgttcatggaggctctccaggctggt
gcagacatctccatgatcgggcagtttggtgtcggattctactcggcctatctagttgca
gagaaagtggttgtgatcacgaagcacaatgatgatgagcagtatgcctgggagtcgtct
gcgggtggctccttcaccgtccgggcagaccatggtgagcccattggccggggtaccaaa
gtgatccttcacctcaaagaagaccagacagagtacttggaggagaggagggtcaaggaa
gtggtgaagaaacattcgcagttcataggctatcccatcaccctctatttggagaaggaa
cgggagaaggagatcagtgatgatgaggcagaggaagagaaaggtgagaaagaggaggaa
gataaggaggatgaggagaagcctaagattgaagatgtgggatccgatgaggaagatgac
agcggcaaagacaagaaaaagaaaacaaagaagatcaaagagaagtacattgaccaggag
gagctgaacaagacaaagcctatctggaccagaaacccggatgacatcacgcaggaggag
tatggcgaattctataagagcctcaccaatgactgggaggaccacttggcagtcaagcac
ttctctgtagaaggtcagttggaattcagggcattgctcttcattccccggcgggctccc
ttcgacctttttgagaacaagaagaagaagaacaacatcaaattgtatgtccgccgtgtg
ttcatcatggacagctgtgacgagctgatacctgagtacctcaactttatccgcggtgtg
gttgactccgaggacctgcccctgaacatctcccgggagatgctgcagcagagcaagatc
ctgaaggtcatccgcaagaacatcgtcaagaagtgcctggagctcttctccgagctggct
gaggacaaggagaactacaagaagttctatgaggccttctccaaaaatttaaagcttgga
attcatgaagattccactaaccgacgccgcctctctgagctccttcgctatcacacctct
cagtctggagatgagatgacctccttgtcagagtatgtgtctcgcatgaaggagacccag
aagtccatctactatatcactggtgagagcaaagagcaagtggccaactctgcctttgtg
gagcgagtgcggaagcggggcttcgaggtggtgtatatgactgagcctattgacgagtac
tgcgtgcagcagctcaaggagtttgatgggaagagcctggtctcagtgactaaggagggc
ctggagctaccagaggacgaggaagagaagaagaaaatggaggagagcaaggcaaagttt
gagaatctctgcaagctcatgaaggagatcttggacaagaaggttgaaaaggtgacaatc
tccaataggcttgtgtcttcaccctgctgcattgtgacaagcacctatggctggacagcc
aacatggaacggatcatgaaggcccaggcactgcgagacaactctacaatgggctacatg
atggccaaaaaacacctggagatcaaccctgaccaccccatcgtggagaccctgcggcag
aaggctgaggcagacaaaaacgacaaagctgtcaaggacctggtggtgctgctgtttgaa
actgctctgctctcctctggtttctcacttgaggatccccaaacccactccaaccgcatc
taccgcatgattaaactaggcctgggcatcgatgaagatgaggtcactgcagaggagccc
agtgctgctgttcctgatgagatcccccctctggaaggcgatgaggatgcctcgcgcatg
gaagaggtggattaa

DBGET integrated database retrieval system