KEGG   Mus musculus (mouse): 15516
Entry
15516             CDS       T01002                                 

Gene name
Hsp90ab1, 90kDa, AL022974, C81438, Hsp, Hsp84, Hsp84-1, Hsp90, Hspcb
Definition
(RefSeq) heat shock protein 90 alpha (cytosolic), class B member 1
  KO
K04079  molecular chaperone HtpG
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04612  Antigen processing and presentation
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04659  Th17 cell differentiation
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu05132  Salmonella infection
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15516 (Hsp90ab1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    15516 (Hsp90ab1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15516 (Hsp90ab1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    15516 (Hsp90ab1)
   04612 Antigen processing and presentation
    15516 (Hsp90ab1)
   04659 Th17 cell differentiation
    15516 (Hsp90ab1)
   04657 IL-17 signaling pathway
    15516 (Hsp90ab1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    15516 (Hsp90ab1)
   04914 Progesterone-mediated oocyte maturation
    15516 (Hsp90ab1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15516 (Hsp90ab1)
  09162 Cancer: specific types
   05215 Prostate cancer
    15516 (Hsp90ab1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    15516 (Hsp90ab1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    15516 (Hsp90ab1)
   05418 Fluid shear stress and atherosclerosis
    15516 (Hsp90ab1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    15516 (Hsp90ab1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15516 (Hsp90ab1)
   04131 Membrane trafficking [BR:mmu04131]
    15516 (Hsp90ab1)
   03051 Proteasome [BR:mmu03051]
    15516 (Hsp90ab1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15516 (Hsp90ab1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15516 (Hsp90ab1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15516 (Hsp90ab1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP90
   15516 (Hsp90ab1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    15516 (Hsp90ab1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15516 (Hsp90ab1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    15516 (Hsp90ab1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15516 (Hsp90ab1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 15516
NCBI-ProteinID: NP_032328
MGI: 96247
Ensembl: ENSMUSG00000023944
Vega: OTTMUSG00000020123
UniProt: P11499 Q71LX8
Position
17 B3; 17 22.59 cM
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaggaggaggtggagacctttgcctttcaggcagaa
attgcccagctcatgtccctcatcatcaacactttctattcaaacaaggagattttcctc
cgcgagttgatctctaatgcttcagatgccctggacaagattcgatatgagagcctgacg
gacccttctaagttggacagtgggaaagagctgaaaattgacatcatccccaaccctcag
gagcgcacgctgactttggtggacacaggcattggcatgaccaaggctgacctcattaat
aacctgggaaccattgctaagtctggcacgaaggcgttcatggaggctctccaggctggt
gcagacatctccatgatcgggcagtttggtgtcggattctactcggcctatctagttgca
gagaaagtggttgtgatcacgaagcacaatgatgatgagcagtatgcctgggagtcgtct
gcgggtggctccttcaccgtccgggcagaccatggtgagcccattggccggggtaccaaa
gtgatccttcacctcaaagaagaccagacagagtacttggaggagaggagggtcaaggaa
gtggtgaagaaacattcgcagttcataggctatcccatcaccctctatttggagaaggaa
cgggagaaggagatcagtgatgatgaggcagaggaagagaaaggtgagaaagaggaggaa
gataaggaggatgaggagaagcctaagattgaagatgtgggatccgatgaggaagatgac
agcggcaaagacaagaaaaagaaaacaaagaagatcaaagagaagtacattgaccaggag
gagctgaacaagacaaagcctatctggaccagaaacccggatgacatcacgcaggaggag
tatggcgaattctataagagcctcaccaatgactgggaggaccacttggcagtcaagcac
ttctctgtagaaggtcagttggaattcagggcattgctcttcattccccggcgggctccc
ttcgacctttttgagaacaagaagaagaagaacaacatcaaattgtatgtccgccgtgtg
ttcatcatggacagctgtgacgagctgatacctgagtacctcaactttatccgcggtgtg
gttgactccgaggacctgcccctgaacatctcccgggagatgctgcagcagagcaagatc
ctgaaggtcatccgcaagaacatcgtcaagaagtgcctggagctcttctccgagctggct
gaggacaaggagaactacaagaagttctatgaggccttctccaaaaatttaaagcttgga
attcatgaagattccactaaccgacgccgcctctctgagctccttcgctatcacacctct
cagtctggagatgagatgacctccttgtcagagtatgtgtctcgcatgaaggagacccag
aagtccatctactatatcactggtgagagcaaagagcaagtggccaactctgcctttgtg
gagcgagtgcggaagcggggcttcgaggtggtgtatatgactgagcctattgacgagtac
tgcgtgcagcagctcaaggagtttgatgggaagagcctggtctcagtgactaaggagggc
ctggagctaccagaggacgaggaagagaagaagaaaatggaggagagcaaggcaaagttt
gagaatctctgcaagctcatgaaggagatcttggacaagaaggttgaaaaggtgacaatc
tccaataggcttgtgtcttcaccctgctgcattgtgacaagcacctatggctggacagcc
aacatggaacggatcatgaaggcccaggcactgcgagacaactctacaatgggctacatg
atggccaaaaaacacctggagatcaaccctgaccaccccatcgtggagaccctgcggcag
aaggctgaggcagacaaaaacgacaaagctgtcaaggacctggtggtgctgctgtttgaa
actgctctgctctcctctggtttctcacttgaggatccccaaacccactccaaccgcatc
taccgcatgattaaactaggcctgggcatcgatgaagatgaggtcactgcagaggagccc
agtgctgctgttcctgatgagatcccccctctggaaggcgatgaggatgcctcgcgcatg
gaagaggtggattaa

DBGET integrated database retrieval system