KEGG   Mus musculus (mouse): 15519Help
Entry
15519             CDS       T01002                                 

Gene name
Hsp90aa1, 86kDa, 89kDa, AL024080, AL024147, Hsp86-1, Hsp89, Hsp90, Hspca, hsp4
Definition
(RefSeq) heat shock protein 90, alpha (cytosolic), class A member 1
  KO
K04079  molecular chaperone HtpG
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04612  Antigen processing and presentation
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04659  Th17 cell differentiation
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    15519 (Hsp90aa1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    15519 (Hsp90aa1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15519 (Hsp90aa1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    15519 (Hsp90aa1)
   04612 Antigen processing and presentation
    15519 (Hsp90aa1)
   04659 Th17 cell differentiation
    15519 (Hsp90aa1)
   04657 IL-17 signaling pathway
    15519 (Hsp90aa1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    15519 (Hsp90aa1)
   04914 Progesterone-mediated oocyte maturation
    15519 (Hsp90aa1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    15519 (Hsp90aa1)
  09162 Cancers: Specific types
   05215 Prostate cancer
    15519 (Hsp90aa1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    15519 (Hsp90aa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    15519 (Hsp90aa1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15519 (Hsp90aa1)
   04131 Membrane trafficking [BR:mmu04131]
    15519 (Hsp90aa1)
   03051 Proteasome [BR:mmu03051]
    15519 (Hsp90aa1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15519 (Hsp90aa1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15519 (Hsp90aa1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     15519 (Hsp90aa1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP90
   15519 (Hsp90aa1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    15519 (Hsp90aa1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    15519 (Hsp90aa1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    15519 (Hsp90aa1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15519 (Hsp90aa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 Zip LOH1CR12
Motif
Other DBs
NCBI-GeneID: 15519
NCBI-ProteinID: NP_034610
MGI: 96250
Ensembl: ENSMUSG00000021270
Vega: OTTMUSG00000019766
UniProt: P07901 Q80Y52
Structure
PDB: 

Position
12 F1; 12 60.75 cM
AA seq 733 aa AA seqDB search
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPSKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYFITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSV
KDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTVDDTSAAVTEEMPPL
EGDDDTSRMEEVD
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggaaacccagacccaagaccaaccaatggaggaggaggaggtcgagaccttt
gcctttcaggcagaaattgcccagttaatgtccttgatcatcaataccttctactcgaac
aaagagatctttctgagggagctcatctccaattcatcggacgctctggataaaatccgt
tacgagagcctgacggaccccagtaaactggactcggggaaggagctgcacatcaatctc
attcccagcaaacaggaccgaaccctgaccattgtggataccgggattggaatgaccaag
gccgacttgatcaataaccttggcaccattgccaagtcgggcaccaaagccttcatggag
gctttgcaggctggtgcagatatctctatgattggccagtttggtgttggtttttactct
gcctatttggttgctgagaaagtgactgtcatcacgaagcataacgacgatgagcagtat
gcctgggagtcctcagctgggggatccttcacagtgaggactgacacaggtgaaccaatg
ggtcgtggaacaaaggttatcttgcatctgaaagaagaccaaacagagtatttggaggaa
aggagaataaaggagatcgtgaagaagcattctcagttcattggctatcccattactctc
tttgtggagaaggaacgagataaggaagtcagtgatgatgaggctgaagaaaaggaagag
aaagaggaagagaaagaaaaagaagaaaaggagtctgatgataaacctgaaatagaagat
gttggctctgatgaagaagaggaggagaagaaggatggtgacaagaagaaaaagaagaag
ataaaggaaaagtacattgatcaagaagaactcaacaaaacaaagccgatttggacgaga
aatcctgatgacatcactaatgaggaatatggagagttctacaagagcttaactaacgat
tgggaagaacacttggcagtaaagcatttttctgttgaaggacaattagaattccgggcc
cttctttttgtcccaagacgcgctccttttgatctgtttgaaaacagaaagaaaaagaac
aacatcaagttgtatgttcgcagagtttttatcatggataactgtgaggaattaatccct
gagtatctgaatttcattagaggggtagtggattctgaggatctccctctaaatatttcc
cgtgaaatgctgcaacaaagtaaaattctgaaagttatcagaaagaatttggtcaagaaa
tgcttagaactatttactgaactagcagaagataaagagaactacaaaaagttttatgag
cagttctcaaaaaatataaagcttggaattcacgaggactctcagaatcggaagaagctt
tcagagctgttgcggtactacacatctgcttctggggacgagatggtttctctgaaggac
tactgtaccagaatgaaggaaaaccagaagcacatctattttatcacaggtgagaccaag
gaccaggttgctaactccgcctttgtggaacgtctccgaaagcatggcttagaagtaatt
tatatgattgagcccattgatgagtattgtgtgcaacagctgaaggaatttgagggcaag
accttggtgtctgttaccaaagaaggactggaacttccagaagatgaagaggaaaagaag
aaacaggaagagaaaaagacaaaatttgagaacctctgcaaaattatgaaagatattttg
gagaagaaggttgaaaaggtggttgtgtcaaaccgactggtgacatccccgtgctgtatt
gtcacaagcacatatgggtggacagcaaacatggagagaatcatgaaagctcaagccctc
agagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaatcctgat
cactccattattgaaaccttaaggcaaaaggcagaggctgacaagaatgacaaatctgtg
aaggatctggtcatcttgctgtatgaaactgcactcctatcttctggcttcagtctggaa
gatccccagacccatgctaacaggatctacaggatgatcaagcttggtctaggtattgat
gaggatgatcctactgtggatgacaccagtgctgctgtaactgaagaaatgcctcccctg
gaaggagatgacgacacatcacgcatggaagaagtagactaa

DBGET integrated database retrieval system