KEGG   Mus musculus (mouse): 15525
Entry
15525             CDS       T01002                                 

Gene name
Hspa4, 70kD, 70kDa, AI317151, APG, APG-2, Hsp1, Hsp110, Hsp7, Hsp70RY, mKIAA4025
Definition
(RefSeq) heat shock protein 4
  KO
K09489  heat shock 70kDa protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
mmu04612  Antigen processing and presentation
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    15525 (Hspa4)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    15525 (Hspa4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    15525 (Hspa4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15525 (Hspa4)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   15525 (Hspa4)
SSDB
Motif
Pfam: HSP70 MreB_Mbl F-box-like_2 Herpes_ICP4_N
Other DBs
NCBI-GeneID: 15525
NCBI-ProteinID: NP_032326
MGI: 1342292
Ensembl: ENSMUSG00000020361
Vega: OTTMUSG00000000056
UniProt: Q3U2G2
Position
11 B1.3; 11 31.91 cM
AA seq 842 aa
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACVSFGPKNRSIGAAAKSQVISNA
KNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAM
LLSKLKETAESVLKKPVVDCVVSVPSFYTDAERRSVMDATQIAGLNCLRLMNETTAVALA
YGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNKGKLKVLATAFDTTLGGRKFDEVL
VNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDIDVSGT
MNRGKFLEMCDDLLARVEPPLRSVLEQSKLKKEDIYAVEIVGGATRIPAVKEKISKFFGK
ELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGLSDCEVF
PKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKV
KVRVNVHGIFSVSSAALVEVHKSEESEEPMETDQNAKEEEKMQVDQEEPHTEEQQQQPQT
PAENKAESEEMETSQAGSKDKKTDQPPQAKKAKVKTSTVDLPIESQLLWQLDREMLGLYT
ENEGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNTFTLKLEDTENW
LYEDGEDQPKQVYVDKLAELKSLGQPIKTRFQESEERPKLFEELGKQIQQYMKVISSFKN
KEDQYEHLDAADVTKVEKSTNEAMEWMNSKLNLQNKQSLTVDPVVKTKEIEAKIKELTSI
CSPIISKPKPKVEPPKEEPKHAEQNGPVDGQGDNPGSQAAEHGADTAVPSDGDKKLPEMD
ID
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgtcggtggtgggcatagacctgggctttcagagctgctatgtcgctgtggcccgcgcc
ggcggcatcgagacgatcgctaacgagtatagcgaccgctgcacgccggcatgtgtttct
tttggtcctaagaatcgttcaattggagcagcagctaagagccaggtaatttctaatgcc
aagaacacagttcaaggctttaaaagattccatgggcgtgcattctccgatccatttgtg
gaagcagaaaaatctaatcttgcatatgatattgtgcagttgcccactggattaacgggc
ataaaggttacatatatggaagaagagaggaattttaccacggaacaagtgactgccatg
cttttgtcgaaactgaaggagacagcagagagtgttcttaagaagcctgtggtagactgt
gttgtctcggttcctagtttctacactgatgcagaacggcggtcagtgatggatgccaca
cagattgctggtctcaattgtttgcggttaatgaatgaaacaactgcagttgctcttgct
tatggaatctataaacaagaccttcctgccttagaagaaaaaccaagaaatgtagttttt
gtagatatgggacattctgcctatcaagtttctgtatgtgcatttaataaaggaaaactg
aaagttttggccacagcttttgatacaacattgggaggcagaaaatttgatgaggtgttg
gtaaatcacttctgtgaagaatttggaaagaaatacaagctagacataaaatctaaaatt
cgtgctttattacgactgtctcaagagtgtgagaaactcaagaaattgatgagtgcgaat
gcttcagacctccctttgagcattgagtgttttatgaatgatattgatgtgtccggaact
atgaatagaggcaaatttttggagatgtgtgatgatctcctagcaagagtggagccgcca
cttcgaagcgtcttggagcaatccaagttaaagaaagaagatatttatgcagtggagata
gttggtggtgccacacgaatccctgcagtgaaagagaagatcagcaagttttttggtaaa
gaactcagcacaacattaaatgcagatgaagctgtcactcgaggctgtgctctgcagtgt
gcaattttatcacctgctttcaaagtcagagaattttctatcactgatgtggtaccatat
ccaatatctttgcgatggaattctccagctgaagaggggttaagtgactgtgaagtcttc
cccaaaaaccatgctgctcctttctccaaagtcctcaccttctacagaaaggaacctttc
actcttgaggcctactatagttctcctcaggatttgccctatccagatcctgctatagct
cagttctcagttcagaaagtcactccacagtctgatggctccagctcaaaagtgaaagtc
aaggtccgggtgaacgtgcacggcatcttcagtgtgtccagtgcggccttggtggaggtg
cacaagtctgaagagagtgaggagcccatggagacggatcagaatgcaaaggaagaggag
aagatgcaagtggaccaggaagaaccacatactgaagagcagcagcagcagccacagaca
ccagcagaaaacaaggcggagtctgaggagatggagacatctcaagctggatcaaaagat
aaaaagacggaccaaccacctcaagcaaagaaggcaaaagtgaagaccagcactgtggac
ctgcccattgagagccagctgctctggcagctggaccgggagatgctcggcctgtacaca
gagaatgagggtaagatgatcatgcaggataaactggagaaggaacggaatgacgccaag
aatgctgtggaagagtatgtgtatgagatgagagacaagcttagtggtgaatatgagaag
tttgtgagtgaagatgatcgtaatacttttaccttaaaattagaggatactgaaaattgg
ctgtatgaagatggagaagatcaaccaaagcaagtttatgtagacaaattggctgaatta
aaaagtttaggtcaacccattaagacacggttccaggaatctgaagaaagaccaaaatta
tttgaagaactagggaagcaaatccaacagtatatgaaagtgatcagctctttcaaaaac
aaggaggaccagtatgaacacttggatgctgctgacgtgacaaaggtagagaaaagcacc
aatgaggcgatggagtggatgaatagcaagcttaacctgcagaacaaacagagcctgacg
gtggatccagttgtcaagacaaaggagattgaagctaaaattaaggagctgacaagtatt
tgcagtcctataatttcaaaacccaaacccaaagtggaacccccaaaggaggaaccaaaa
catgctgagcagaatggaccagtggatggccaaggagacaacccaggctcccaggctgct
gagcacggtgcagacacagctgtgccttctgatggcgacaagaagcttcctgagatggac
attgattga

DBGET integrated database retrieval system