KEGG   Mus musculus (mouse): 15526Help
Entry
15526             CDS       T01002                                 

Gene name
Hspa9, 74kDa, Csa, Grp75, Hsc74, Hsp74, Hsp74a, Hspa9a, Mortalin, Mot-2, Mot2, Mthsp70, Pbp74
Definition
(RefSeq) heat shock protein 9
  KO
K04043  molecular chaperone DnaK
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    15526 (Hspa9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15526 (Hspa9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    15526 (Hspa9)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    15526 (Hspa9)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15526 (Hspa9)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15526 (Hspa9)
Messenger RNA biogenesis [BR:mmu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     15526 (Hspa9)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   15526 (Hspa9)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    15526 (Hspa9)
  Matrix
   MMC/PAM proteins
    15526 (Hspa9)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    15526 (Hspa9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   15526 (Hspa9)
  Exosomal proteins of breast cancer cells
   15526 (Hspa9)
  Exosomal proteins of colorectal cancer cells
   15526 (Hspa9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C FtsA
Motif
Other DBs
NCBI-GeneID: 15526
NCBI-ProteinID: NP_034611
MGI: 96245
Ensembl: ENSMUSG00000024359
Vega: OTTMUSG00000037646
UniProt: P38647
Position
18 B1; 18 18.8 cM
AA seq 679 aa AA seqDB search
MISASRAAAARLVGTAASRSPAAARPQDGWNGLSHEAFRFVSRRDYASEAIKGAVVGIDL
GTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYAT
KRLIGRRYDDPEVQKDTKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAEN
YLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVI
AVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTK
DNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVTDLIK
RTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIG
AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQT
QVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTG
REQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFK
DQLPADECNKLKEEISKMRALLAGKDSETGENIRQAASSLQQASLKLFEMAYKKMASERE
GSGSSGTGEQKEDQKEEKQ
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgataagcgccagcagagccgcggccgcgcgtctcgtgggcaccgctgcgtcccggagc
cccgcagccgcccgtccccaggatggctggaatggccttagccatgaggcttttagattt
gtttcaagaagagattatgcatcagaagcaatcaagggtgcagtggttggtattgatttg
ggtactactaactcctgtgtggctgttatggagggcaaacaagcaaaggtcctggagaat
gctgaaggtgccagaactaccccttctgtggttgcctttacagcagatggagaacgactt
gttggtatgccagcaaaacggcaagctgtcaccaatccaaacaataccttctatgctact
aagcgtcttattggacgacgatatgatgaccctgaagtacagaaagacactaagaatgtt
ccttttaaaattgtccgtgcctccaatggtgatgcttgggttgaggctcatggaaaactc
tattctccaagtcagattggagcatttgtgttgatgaagatgaaagagactgcagaaaat
tacttgggccacacagcaaaaaatgctgtgatcacagtccctgcttatttcaatgattca
cagcgacaggccactaaggatgctggccagatatctgggctaaatgtgcttcgagtgatc
aatgagcctacagctgctgctctagcttacggtctggacaaatctgaagataaagtcatt
gctgtgtatgatttaggtggtggaacctttgacatttctatcctggaaattcagaaagga
gtgtttgaggtgaaatctaccaatggggacactttcttaggaggggaagactttgaccaa
gctttgttgcggcacattgtcaaggagttcaagagagagacaggggttgatttgaccaaa
gacaacatggcgcttcagagggttcgggaagctgctgagaaggctaaatgtgaactttcc
tcatctgtgcagactgacatcaacttgccataccttaccatggatgcttctggaccaaag
catttgaatatgaagctgactcgagctcagtttgaaggcattgtcacagatctaatcaag
agaactattgctccgtgtcagaaagctatgcaggatgcagaagtcagcaagagtgacata
ggagaagtgattctggttggtggcatgacaaggatgcccaaggttcagcagactgtacaa
gatctttttggcagagccccgagtaaagctgttaatcctgatgaggctgtagccatcgga
gctgccatccagggaggtgtgttggctggtgacgttacagacgtgctgctcctggatgtc
actcccctctctctgggtattgagactctgggaggcgtctttaccaaacttattaatagg
aacaccactattccaaccaaaaagagccaggtgttttctactgctgctgatggacaaact
caagtagagattaaagtgtgtcagggggaacgagagatggctggagacaacaaacttcta
ggacagttcactttgattggaattcccccagcccctcgtggagtgccccagattgaagtt
acatttgacattgatgccaatgggattgtgcacgtttctgccaaagataaaggcactggt
cgtgagcaacagattgtaatccagtcttctggtggattaagcaaagatgatattgaaaat
atggttaaaaatgcagagaagtacgctgaggaagaccgcaggaagaaggaacgtgttgaa
gcagttaatatggctgaaggaattattcatgacacagaaaccaagatggaagaatttaag
gaccagttgcctgctgatgagtgcaacaagctaaaggaagagatttccaaaatgagagcg
ctccttgctggaaaggacagtgagacaggagagaacatcaggcaggcagcatcttcccta
cagcaggcgtcattgaaactcttcgaaatggcgtacaaaaagatggcatctgaacgggaa
ggttctggaagttctggcactggggaacagaaggaagatcagaaggaagagaaacagtaa

DBGET integrated database retrieval system