KEGG   Mus musculus (mouse): 15530
Entry
15530             CDS       T01002                                 

Gene name
Hspg2, AI852380, HSPG, Pcn, Plc, p, per
Definition
(RefSeq) perlecan (heparan sulfate proteoglycan 2)
  KO
K06255  basement membrane-specific heparan sulfate proteoglycan core protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
mmu05161  Hepatitis B
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    15530 (Hspg2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    15530 (Hspg2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    15530 (Hspg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15530 (Hspg2)
   00535 Proteoglycans [BR:mmu00535]
    15530 (Hspg2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   15530 (Hspg2)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   15530 (Hspg2)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig Laminin_B V-set Laminin_G_1 Laminin_G_2 Laminin_EGF Ig_6 Ldl_recept_a Ig_5 Izumo-Ig Laminin_G_3 EGF hEGF
Other DBs
NCBI-GeneID: 15530
NCBI-ProteinID: NP_032331
MGI: 96257
Ensembl: ENSMUSG00000028763
Vega: OTTMUSG00000009935
UniProt: Q05793 Q3UHH3 E9PZ16 Q2XQV0 Q52KG8
Structure
PDB: 
1GL4

Position
4 D3; 4 69.93 cM
AA seq 4383 aa
MGQRAVGSLLLGLLLHARLLAVTHGLRAYDGLSLPEDTETVTASRYGWTYSYLSDDEDLL
ADDASGDGLGSGDVGSGDFQMVYFRALVNFTRSIEYSPQLEDASAKEFREVSEAVVEKLE
PEYRKIPGDQIVSVVFIKELDGWVFVELDVGSEGNADGSQIQEVLHTVVSSGSIGPYVTS
PWGFKFRRLGTVPQFPRVCTETEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVPE
LSSSTPAVGKVSPLPLWPEAATTPPPPVTHGPQFLLPSVPGPSACGPQEASCHSGHCIPR
DYLCDGQEDCRDGSDELGCASPPPCEPNEFACENGHCALKLWRCDGDFDCEDRTDEANCS
VKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQQSIQASR
GQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGGRGTLIIRDVKEADQGAYTCE
AMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDSASCLPCFCFGVTNVCQSSLRFRDQI
RLSFDQPNDFKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFLVHDAFWALPK
QFLGNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGAGYRLHSRGHTPTHPGTLNQR
QVQLSEEHWVHESGRPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTT
IHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHC
LNCQHNTEGPQCDKCKPGFFGDATKATATACRPCPCPYIDASRRFSDTCFLDTDGQATCD
ACAPGYTGRRCESCAPGYEGNPIQPGGKCRPTTQEIVRCDERGSLGTSGETCRCKNNVVG
RLCNECSDGSFHLSKQNPDGCLKCFCMGVSRQCSSSSWSRAQVLGASEQPSQFSLSNAAG
THTTSEGVSSPAPGELSFSSFHNLLSEPYFWSLPASFRGDKVTSYGGELRFTVTQRPRPS
SAPLHRQPLVVLQGNNIVLEHHASRDPSPGQPSNFIVPFQEQAWQRPDGQPATREHLLMA
LAGIDALLIQASYTQQPAESRVSGISMDVAVPENTGQDSAREVEQCTCPPGYRGPSCQDC
DTGYTRVPSGLYLGTCERCNCHGHSETCEPETGACQSCQHHTEGASCEQCQPGYYGDAQR
GTPQDCQPCPCYGAPAAGQAAHTCFLDTDGHPTCDSCSPGHSGRHCERCAPGYYGNPSQG
QPCHRDGQVPEVLGCGCDPHGSISSQCDAAGQCQCKAQVEGRTCSHCRPHHFHLSASNPE
GCLPCFCMGVTQQCASSSYSRQLISTHFAPGDFQGFALVNPQRNSQLTGGFTVEPVHDGA
RLSFSNFAHLGQESFYWQLPEIYQGDKVAAYGGKLRYTLSYTAGPQGSPLLDPDIQITGN
NIMLVASQPALQGPERRSYEIIFREEFWRRPDGQPATREHLLMALADLDELLVRATFSSV
PRAASISAVSLEVAQPGPSSGPRALEVEECRCPPGYVGLSCQDCAPGYTRTGSGLYLGQC
ELCECNGHSDLCHPETGACSRCQHNTAGEFCELCATGYYGDATAGTPEDCQPCACPLTNP
ENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYEGDPNVQGGRCQPLTKESLEVQI
HPSRSVVPQGGPHSLRCQVSGSPPHYFYWSREDGRPLPSSAQQRHQGSELHFPSVQPSDA
GVYICTCRNLIHTSNSRAELLVAEAPSKPITVTVEEQRSQSVRPGADVTFICTAKSKSPA
YTLVWTRLHNGKLPSRAMDFNGILTIRNVQPSDAGTYVCTGSNMFAMDQGTATLHVQVSG
TSTAPVASIHPPQLTVQPGQQAEFRCSATGNPTPMLEWIGGPSGQLPAKAQIHNGILRLP
AIEPSDQGQYLCRALSSAGQHVARAMLQVHGGSGPRVQVSPERTQVHEGRTVRLYCRAAG
VPSASITWRKEGGSLPPQARSENTDIPTLLIPAITAADAGFYLCVATSPTGTAQARIQVV
VLSASGANSVPVRIESSSPSVTEGQTLDLNCAVMGLTYTQVTWYKRGGSLPPHAQVHGSR
LRLPQVSPADSGDYVCRVESDVGPKEASIVVSVLHSPHSGPSYTPATSITPPIRIESSSS
HVAEGQTLDLNCVVPGQAQVTWRKRGGSLPARHQTHGSLLRLHQVSPADSGEYVCHVVLG
SEHTETSVLVTIEPAESIPAPGPAPPVRIEASSSTVTEGHMLDLNCVVAGQAHAQVTWYK
RGGSLPARHQVRGSRLYILQASPADAGEYVCRAGNGQEATITVTVTRNHGANLAYPPGST
SPIRIESSSSHVAEGQTLDLNCVVQGQAHAQVTWHKRGGSLPARHQTHGSLLRLHQVSPV
DSGEYVCRVEGGAVPLESSVLVTIEPAGTAPGVIPPVRIESSSSHVSEGQSLDLNCLVSG
QTHPQISWHKRGGSLPARHQVHGSRLRLLQVTPTDSGEYVCRVVSGSGTQEASILVTIQQ
TLSPSHSQSVVHPVRIESSSPSLANGHTLDLNCLVASLTPHTITWYKRGGSLPSRHQIVG
SRLRIPQVTPADSGEYVCHVSNGAGSQETSLIVTIESRGPSHVPSVSPPMRIETSSPTVT
EGQTLDLNCVVVGRPQATITWYKRGGSLPFRHQAHGSRLRLHHMSVADSGEYVCRANNNI
DAQETSIMISVSPSTNSPPAPASPAPIRIESSSSRVAEGQTLDLNCVVPGHAHAQVTWHK
RGGSLPTHHQTHGSRLRLYQVSSADSGEYVCSVLSSSGPLEASVLVSITPAAANVHIPGE
VPFPPIRIETSSSRVAEGQTLDLSCVVPGQAHAQVTWHKRGGSLPAGHQVHGHMLRLNRV
SPADSGEYSCQVTGSSGTLEASVLVTIEASEPSPIPAPGLAQPVYIESSSSHLTEGQTVD
LKCVVPGQAHAQVTWHKRGSSLPARHQTHGSLLRLYQLSPADSGEYVCQVAGSSHPEHEA
SFKLTVPSSQNSSFRLRSPVISIEPPSSTVQQGQDASFKCLIHEGATPIKVEWKIRDQEL
EDNVHISPNGSIITIVGTRPSNHGAYRCVASNVYGMAQSVVNLSVHGPPTVSVLPEGPVH
VKMGKDITLECISSGEPRSSPRWTRLGIPVKLEPRMFGLMNSHAMLKIASVKPSDAGTYV
CQAQNALGTAQKQVELIVDTGTVAPGAPQVQVEESELTLEAGHTATLHCSATGNPPPTIH
WSKLRAPLPWQHRIEGNTLVIPRVAQQDSGQYICNATNSAGHTEATVVLHVESPPYATII
PEHTSAQPGNLVQLQCLAHGTPPLTYQWSLVGGVLPEKAVARNQVLRLEPTVPEDSGRYR
CQVSNRVGSAEAFAQVLVQGSSSNLPDTSIPGGSTPTVQVTPQLETRNIGASVEFHCAVP
NERGTHLRWLKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYVCQAHGPWGQAQATAQLIVQ
ALPSVLINVRTSVHSVVVGHSVEFECLALGDPKPQVTWSKVGGHLRPGIVQSGSIIRIAH
VELADAGQYRCAATNAAGTTQSHVLLLVQALPQISTPPEIRVPAGSAAVFPCMASGYPTP
AITWSKVDGDLPPDSRLENNMLMLPSVRPEDAGTYVCTATNRQGKVKAFAYLQVPERVIP
YFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKRSPTNLANRQPDFISFG
LVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSLIVGNLAPVNGTSQGKF
QGLDLNEELYLGGYPDYGAIPKAGLSSGFVGCVRELRIQGEEVVFHDVNLTTHGISHCPT
CQDRPCQNGGQCQDSESSSYTCVCPAGFTGSRCEHSQALHCHPEACGPDATCVNRPDGRG
YTCRCHLGRSGVRCEEGVTVTTPSMSGAGSYLALPALTNMHHELRLDVEFKPLEPNGILL
FSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSHEPLTLGRWHRVSAERLNKDGSL
RVDGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVQLSPATNMSAHFHGCVGEVSVNGKRL
DLTYSFLGSQGVGQCYDSSPCERQPCQNGATCMPAGEYEFQCLCQDGFKGDLCEHEENPC
QLHEPCLNGGTCRGARCLCLPGFSGPRCQQGAGYGVVESDWHPEGSGGNDAPGQYGAYFY
DNGFLGLPGNSFSRSLPEVPETIEFEVRTSTADGLLLWQGVVREASRSKDFISLGLQDGH
LVFSYQLGSGEARLVSEDPINDGEWHRITALREGQRGSIQVDGEDLVTGRSPGPNVAVNT
KDIIYIGGAPDVATLTRGKFSSGITGCIKNLVLHTARPGAPPPQPLDLQHRAQAGANTRP
CPS
NT seq 13152 nt   +upstreamnt  +downstreamnt
atggggcagcgggcagtgggctcgttgctgctggggctgctgctgcacgcgcggctgcta
gcggtgacgcatgggctgagggcctacgatggcctttccctccctgaggacacagagact
gtcacagcgagccggtatggctggacctactcatacctctctgatgatgaggacctgctg
gcagatgatgcatcaggagatggcctcggcagcggagacgtgggcagcggggacttccag
atggtctatttccgggctctggtaaattttactcggtccattgagtacagcccccagctg
gaggatgcaagtgccaaggagttccgagaggtgtcggaggctgtggtagaaaagctggag
cccgaatacaggaagatccccggagaccagattgtcagtgtggtgttcatcaaggaactg
gatggctgggtctttgttgagctggatgttggctccgaagggaatgcggacggatctcag
attcaagaggtgctgcatacagtggtctccagtggctccatcggcccctatgtcacctcc
ccctgggggttcaagttccgacgcctgggcacagtgccccagttcccaagagtctgcacg
gagacggagtttgcttgccacagctataatgagtgtgtggctctggagtatcgctgtgac
cggaggcctgactgcagggacatgtctgatgaactcaactgtgaggaaccagtccccgag
ctcagctcctcgacacctgctgtggggaaggtgtcacctttaccactctggccagaagca
gccacaacacctccaccgccagtcacgcatggacctcagtttctgttacccagtgttcct
gggccctcagcctgtgggccccaggaggcctcgtgccacagcggacactgcatcccccga
gactacctctgtgatggacaggaagactgcagggatggcagtgacgaactgggctgtgcg
tcccctccaccctgtgagcctaacgagttcgcctgtgaaaatgggcactgtgctctcaag
ttgtggcgctgtgacggtgactttgattgtgaggaccggacagatgaggccaattgttct
gtcaagcagcctggagaagtatgtgggcccacgcacttccagtgtgtctccaccaaccgc
tgcatcccagccagcttccactgtgacgaggaatccgactgtcccgaccgcagtgatgag
tttggctgcatgcctccccaggtagtgacgcctccacagcagtccatccaggcttcccgg
ggccagacagtgactttcacctgcgtagccactggtgtccccacacccatcatcaactgg
aggctcaactggggccacatccctgctcatcccagggtgacaatgaccagcgagggtggg
cgtggcacgctgatcatccgtgacgtgaaggaggcagaccagggcgcatacacctgtgag
gccatgaactcgcgtggcatggtgttcggcattccagacggcgtgctggagcttgtcccg
cagcgagggccctgccctgacgggcacttctacctggaagacagtgcctcctgcctgccc
tgcttctgctttggtgtgaccaacgtgtgccagagcagcctgcgcttccgggaccagatc
cgactgagctttgaccagcccaatgacttcaagggtgtgaatgtgacgatgccctcccag
cccggcgtgccacccctctcctccacccagctgcagatcgaccccgccctgcaggagttc
cagctggtcgacctgtctcgccgcttccttgtccacgatgctttctgggccctacccaag
cagtttctgggcaacaaggtggactcctatggaggcttcctgcgctacaaggtgcgctat
gaactggcacgaggcatgctggagccggtgcagaaaccagatgtgatcctcgtgggtgcg
gggtaccgcctacactctcgaggccacacccccacccatcctggaactctgaaccagcgt
caggtccagctctcagaggaacactgggtccacgagtctggccggcctgtccagcgggct
gagatgctgcaggccctggcgagcctggaggctgtcctgctacagacagtgtataacacc
aagatggccagtgtggggctgagtgacattgtcatggacaccactgtcacccataccacc
atccatggccgggctcacagtgtagaggagtgcagatgccccattggctattctggtttg
tcttgcgagagctgcgatgcccacttcacccgcgtgcctggcgggccctacctgggtact
tgctctggctgtaattgcaatggccatgccagctcctgtgaccctgtctacggccactgc
ctgaattgccagcacaacacagaaggacctcagtgtgacaagtgtaagcctggcttcttt
ggagatgccacaaaggccacagccactgcctgccggccctgtccctgcccatacatcgac
gcttcccgaaggttctcagacacttgcttcctggacacggacggccaagccacttgcgac
gcttgtgccccaggttacacaggccgccgctgtgagagctgtgcccctggatatgaaggc
aaccccatccagcctggcgggaagtgcaggcccaccacccaggaaattgtgcgctgtgat
gagcgagggagcctgggcacctcaggggagacttgccgctgtaagaacaatgtagtgggg
cgcttgtgcaacgagtgctcggacggctcgttccacctgagcaagcaaaacccggacggc
tgcctcaagtgcttctgcatgggagttagtcgccagtgcagcagctcctcctggagccgc
gcccaggtgctcggggcctcggaacagccctctcagttcagcctgagcaacgccgccggc
acccacaccaccagcgagggggtctcgtcccctgcacccggggagctgtcgttctcttcc
ttccacaacctcctgtctgaaccctacttctggagtcttcccgccagcttccgaggggac
aaggtgacgtcctacggcggagagctgcgcttcactgtgacgcagaggccccggcccagt
tctgcgcccctgcacagacagcccctggtggtgttgcagggcaacaacattgtgttggag
catcatgcctcgagggatcccagccctggccagcccagcaacttcatagtgcccttccaa
gagcaagcgtggcagcggcctgatgggcagccggccacacgggagcacctgctgatggcc
ctggcaggcattgatgccctcctcatccaagcatcttacacgcagcaaccggctgagagc
agggtctctggtatcagcatggatgtggctgtgccagagaacaccggccaggactcagcc
cgggaagtagagcagtgtacctgcccccctggttaccgcggcccttcctgccaggactgt
gacacaggttacacacgtgtgcccagcgggctctacctgggcacctgtgagcgctgtaac
tgccatggccactcagagacctgtgagcctgagacaggggcgtgccagagctgccagcac
cacacggagggtgctagctgtgaacagtgccagccagggtactatggggatgcccaacgg
ggcacaccacaggactgccagccctgcccatgctacggagcccctgctgctggccaagct
gcccacacttgtttcctggacacagatggccaccccacttgtgactcatgctcaccagga
cacagcgggcgtcactgtgagaggtgtgccccaggttactatggcaaccccagccagggc
cagccctgccacagagatggtcaggtgccagaggtgctgggctgtggctgtgacccccat
ggcagcatcagcagccagtgtgacgccgctggtcagtgccagtgcaaggcccaggtggag
ggccgtacttgcagtcactgccgacctcaccacttccacctgagtgccagcaacccggaa
ggctgcctgccctgtttctgcatgggtgtcacccagcagtgtgccagctcctcttactcc
cgccagctgatctctacccactttgctcctggggacttccaaggctttgctctggtgaac
cctcaacgcaacagccaactgacagggggcttcaccgtggaaccagtgcacgatggggcc
cgcctctctttcagcaactttgcccacctcggccaagagtccttctactggcagctgcca
gaaatataccaaggagacaaggtggcagcctatggcgggaagctgcggtacaccctctcc
tacacagccgggccacagggcagcccactcttggaccctgatatccagattacgggcaat
aacatcatgttggtggcttcccagccagcactacagggcccagagaggaggagctatgag
atcatcttccgagaggagttctggcggcggccagatggacagcctgcgacccgagagcat
ttgctcatggccctggcagatctggatgaacttctggtgcgggccacattctcctctgtg
ccacgggcagccagtatcagtgccgtgagcctagaagtggcccagccagggccctccagt
ggaccccgagccctcgaggtggaagagtgtcgctgccccccaggctatgttggcttgtcc
tgccaggactgtgccccgggctacactcgcactgggagcggactgtaccttggtcagtgc
gagttgtgtgaatgcaacggccactccgacttgtgtcacccggagactggagcctgctcg
cgatgtcagcacaacacagccggtgagttctgtgagctgtgtgcaactggttactatgga
gatgccacggctgggacgcctgaggattgccagccctgtgcctgcccgctgaccaaccca
gagaacatgttctcccgcacctgtgagagccttggagctggagggtaccgctgcaccgcc
tgtgaacctggctacactgggcagtactgtgagcagtgtgccccaggctatgagggtgac
cccaatgtacaaggaggccggtgccagccactgacaaaagagtccctggaggttcagatc
catccatctcggagcgtggttccccaaggcggcccacactccctgaggtgccaggtcagt
gggagcccaccacactacttctactggtcccgtgaagatggacggcccttgcccagcagc
gctcaacagcggcatcaaggctctgagctccacttccctagcgtgcagccctccgacgcc
ggcgtctacatctgtacctgccgaaacctgattcacacgagcaacagcagggctgagcta
ctggtcgctgaggctcccagcaagcccatcacagtgacagtggaggagcagcggagccag
agtgtgcggcccggagctgacgtcactttcatctgtacggccaagagcaaatccccagcc
tacaccctggtatggacccgtctgcacaatgggaagctgccgtcccgtgctatggacttc
aacggcatcctgaccattcgcaatgtgcagccaagtgacgcgggcacctacgtgtgtact
ggctccaacatgttcgctatggaccagggcacagccacactgcatgttcaggtctcaggt
acctccactgcccctgtggcctccatacaccctccacagctcaccgtgcagccgggacaa
caggctgagttccgctgtagcgccacggggaaccccacccccatgctggaatggataggg
ggtcctagcggccagcttcctgcgaaggctcagatccacaacggcatcctgcgcttgcca
gccattgaaccctcggatcagggccagtacctgtgccgtgccctcagcagcgctgggcag
catgtggccagggctatgcttcaggtgcacgggggcagtggacccagggtccaggttagc
cccgagaggacccaggtgcatgaaggccgcacagtgaggctgtactgcagggcagcaggg
gtacccagtgccagcatcacctggaggaaggagggaggcagcctgcccccacaggcccgg
tcagagaacacagacatccccacactgctcatcccagccattacagctgctgacgctggc
ttctacctctgtgtggccaccagccccacaggcaccgcccaggcacgcattcaggtggtc
gtcctctcagcttcgggtgccaactcagtgccagtcaggatagaatcctcgtcgccatcc
gtgactgaaggacagacgcttgaccttaactgtgcggtgatggggttgacctacacccag
gtcacatggtacaagcgagggggcagcctgcctccccatgcccaggtccacggctcccgg
ctgcggctcccgcaggtctcaccggcagactccggagactatgtgtgccgagtggagagt
gacgtgggccctaaggaggcttccattgttgtctctgtccttcacagcccccattcaggc
cccagctacaccccagccaccagcatcaccccacccatccgcattgaatcctcgtcctcc
cacgtggccgaaggacaaaccctggatctgaactgcgtggtgcctgggcaggcacaggtg
acgtggcgcaaacgtggaggcagccttcctgcccggcaccagacccatggttccctgctg
agactacaccaggtgtcccctgccgactcaggcgagtatgtgtgccatgtcgtcctgggc
tctgagcacacagaaacctctgtcctggtcaccatcgaacctgccgagtctatccctgcc
cctgggcctgcccctcctgtcagaattgaggcctcatcctccactgtgactgagggtcac
atgctggatctcaactgtgtggtggcaggacaggcccacgcgcaggtcacatggtacaag
cgtgggggcagcctgccagcccggcatcaggtccgcggctcccgcctgtacatcttacag
gcttccccagcagatgctggagaatatgtgtgcagggcaggcaatgggcaggaagccacc
atcacagtcacggtcacacgcaaccatggggccaaccttgcctaccccccgggtagcacg
tcacccatccgcattgagtcctcttcctctcacgtggctgaggggcagaccctggatcta
aattgtgtggtgcaaggacaggcccatgcccaagtcacatggcacaagagaggaggcagc
ctgcctgcccggcaccagacccatggctccctgctgcggctgcaccaggtgtctcctgtg
gactcaggagaatatgtgtgccgagtggagggaggggccgtgcctctggagagctctgtc
ctggtgaccattgagcctgcaggcactgcacctggggtcatccctccagtccgaatcgaa
tcatcttcctcccacgtgtcggaggggcagagtctggatctgaattgccttgtttctggg
cagactcacccccagatctcctggcacaagcgtgggggcagcctccctgcccggcatcag
gtacatggctcaagactgagacttctccaggtgaccccaactgactctggagagtatgta
tgccgagtcgtcagtggctcgggcacccaagaagcttctatccttgtcaccatccagcag
accctcagcccctcccactcccagagcgtggtgcacccagtgcgcattgaatcctcgtca
ccttcgctggccaatgggcatactctggacctgaactgcctggttgccagcctcaccccc
cacaccatcacctggtacaagcgcggaggcagcttacccagccggcatcagattgtgggc
tcccgcctccggatccctcaagtgaccccagcagactccggagagtatgtgtgtcacgtc
agtaacggcgctggctcccaggagacctctctcatcgttaccatcgagagcagagggcca
tcccatgtgcccagtgtctccccaccaatgagaattgagacctcatctcccacagtgacg
gaaggacagaccctggatctgaactgtgtggtggtcgggcggcctcaggctaccatcaca
tggtacaagcgtgggggcagcctgccattcagacaccaggcccatggctctcgtctacgg
ctacaccacatgtcggtggctgactccggcgagtatgtgtgccgagccaacaacaacatt
gatgcccaggagacctccatcatgatctcggtctcccctagcaccaacagcccccctgcc
cccgccagccctgcacccatcagaatagagtcttcctcttcacgtgtggccgaaggacag
accctggatctgaactgtgtggtccctgggcacgcccatgcccaggtcacatggcacaag
cgagggggtagcctgcccactcatcatcagacgcacggctcaaggctgcggctataccag
gtgtcctcagccgactcgggcgaatatgtgtgcagcgttctgagcagctctggccctctg
gaggcttccgtcctggtctcgattacaccagctgccgctaatgtccacatccctggtgag
gttcctttcccgcccatccgcatcgagacttcctcctcccgagtggctgaggggcagacc
ctggatctaagctgtgtggttcctgggcaggcccatgcccaggtcacatggcacaaacgt
ggaggcagcctgcccgctgggcaccaggtccatggccacatgctgagactgaaccgtgtg
tccccggcggactctggcgagtactcatgccaagtgacgggcagctcaggtaccctggag
gcttctgtcctggtcaccatcgaggcctctgaacccagccctatccctgccccgggcctg
gcccagcctgtctacatagagtcctcctcctcccatttgactgaagggcagactgtagat
ctgaagtgcgtggtaccagggcaagcccatgcccaggtcacatggcacaaacgagggagc
agcctgcctgcccgacaccagactcatggctccctgctgaggctctaccagctctcccct
gctgactccggcgagtacgtgtgccaagtggctggtagctcccaccctgagcatgaggct
tccttcaagctcacagtaccctccagccaaaactcttccttccgcctcagaagccccgtc
atctccattgaaccacccagcagcacggtacagcagggccaagatgccagtttcaagtgc
cttattcacgagggagcaacgcccatcaaggttgagtggaagattcgggaccaagagctg
gaggacaacgtccacatcagccccaacggctccatcattaccatcgtgggcacccggccc
agcaaccatggagcctaccgctgcgtggcttccaatgtctatggtatggcccagagtgtc
gtcaatctcagcgtgcatgggccccctacggtgtctgtgctccccgagggccctgtgcat
gtgaagatggggaaggacatcaccctggagtgcatcagttctggagaaccgcgctcttcc
cctcgttggacccgactcggcatccctgtcaagttggagccgcggatgtttgggctcatg
aatagccatgcgatgctgaagatcgcatccgtgaaaccatcagacgcaggcacctacgtg
tgccaagcccagaacgccctaggcacagcacagaagcaagtggagctgatcgtggacact
ggcaccgtggccccgggggctccccaggtccaagttgaagaatctgagctgaccttggag
gctggccacacggccactttacactgctcagccacgggcaaccctccacccaccatccac
tggtccaagctgcgcgccccactgccctggcagcaccggatagaaggcaacacactggtc
attccccgggtggcccagcaggactcaggacagtacatctgtaacgccaccaactctgct
gggcacactgaagccaccgttgtcctgcatgtggagagtcctccatatgccaccataatt
ccagaacatacctcggcgcagccagggaacctggttcagctgcagtgcctggctcacggc
acgcccccgctcacctaccagtggagccttgtgggcggcgtcctccccgagaaggcggtt
gccaggaaccaggtgctgcgcctggagcccacagtccccgaagactctggccgctaccgc
tgccaggtctccaacagggtgggctccgcggaggcctttgctcaagtcctggtccaaggc
tcctctagcaatctccctgacacttccatcccaggaggatccacacccactgtgcaagtc
actcctcagctagagacccggaacataggggccagcgttgagttccactgtgctgtgccc
aatgagcgtggcacccaccttcgctggctcaaggagggcggtcagctgcctcctggacac
agtgtacaagatggagtcctcagaatccagaacttagaccagagctgccaagggacatat
gtctgtcaggcccatgggccttggggacaagcccaggccactgcccagctgatcgttcaa
gccttgccctccgtgctcatcaacgtccgaacctccgtgcactctgtggtagtcggccac
tctgtggagtttgagtgcttggccctgggtgaccctaagcctcaggtgacatggagcaaa
gtcgggggacacctacggcctggcatcgtgcaaagcggaagcatcatcaggattgcccac
gtggagctggctgatgcaggacagtaccgctgtgcagctaccaacgctgcgggcaccacc
cagtcccacgtgctgctgctagtacaagccttgccccagatctcaactcccccggagatc
cgagtgcctgccggttctgcggctgtcttcccgtgcatggcctcaggctacccgacgcct
gccatcacctggagtaaggtggacggtgacctgccacccgacagtcgcctggaaaacaat
atgctgatgctaccatcagttcgccccgaggatgccggcacctacgtgtgcactgccacc
aaccggcagggcaaggtcaaagcctttgcctatctgcaggtgccagagcgagtgataccc
tacttcacccagacaccctactccttcctgccacttcccaccatcaaagatgcctacagg
aagtttgagatcaagatcaccttccggccagactctgcggatgggatgctgctgtacaat
gggcagaagcggagtcccaccaacctagccaacagacagccagatttcatctcctttggc
ctcgtgggcggaaggcctgagtttcgatttgatgcaggctctggcatggccactatccgc
caccccacacctctggccctaggccagttccacaccgtgaccctgttacgaagcctcact
caaggatctctgattgtgggcaatttggcccctgtcaacgggacctcccagggcaagttc
caaggtttagacctgaacgaggagctgtatctgggtggctaccctgactacggtgccatc
cccaaggctgggctgagtagcggctttgtaggctgtgtacgtgagctgcgtatccaaggc
gaggaggttgtcttccatgacgtcaacctcacaacacatggcatctcccactgccctact
tgccaggaccgaccctgccagaatgggggccagtgccaagattccgagagcagcagttac
acgtgtgtctgccctgctggcttcaccggcagccgctgtgaacattcgcaagccctgcac
tgccaccccgaggcctgtgggccggacgccacttgtgtgaaccggccagacggtcgaggc
tacacctgtcgctgccacctgggccgctccggggtgaggtgtgaagaaggtgtaacggtg
accaccccatcgatgtctggtgctggttcctacctggcactaccggctctcaccaacatg
caccatgagctacgcctggatgtggagttcaagccgctggaacccaatgggatcttactg
ttcagtgggggcaagagcgggcctgtggaagactttgtgtccctagcaatggttggtggc
cacctggagttccgctatgagttagggtcaggtctggctgttctgcggagccacgagcca
ctgaccttaggacgctggcaccgagtgtctgcggaacgcctgaacaaagatggcagcctg
cgggtggatggagggcgtcctgtgttacgctcttcaccaggaaagagccagggccttaac
ctgcataccctgctctacctgggtggtgtggagccctcggtacagctgtccccagccacc
aatatgagtgctcacttccatggctgtgtgggtgaggtatctgtgaatggcaagcggttg
gacctcacctacagcttcttgggcagccagggtgtgggccagtgctatgacagctccccg
tgcgagcgccagccctgccagaatggcgccacatgcatgcctgcgggcgaatatgagttc
cagtgcctctgtcaagatggcttcaaaggagacctttgtgaacatgaggagaacccgtgc
cagctgcatgaaccatgtctgaatggtggcacctgccggggtgcccgatgcctctgtctg
cctggcttctctggtccacgctgccaacaaggcgctggatatggggtagtggagtcagac
tggcaccctgaaggcagtggaggcaatgatgcccctgggcaatacggagcctacttttat
gacaatggcttcctaggcctccctggtaacagtttctcaaggagcctgcctgaagtaccc
gagacaattgaattcgaggttcggaccagcacagccgatggcctcctgctctggcagggt
gtggtgagagaggccagccgcagcaaggacttcattagccttggactacaggatggccat
ctagtgttcagctaccaactgggcagtggggaggcccgtcttgtctcagaagatcccatc
aatgacggcgagtggcatcggataacagcgctgcgagagggccagagaggctccatccaa
gtagacggtgaggatctggtcaccggccggtccccaggtcctaatgtggcggtcaacacc
aaggacatcatctacattggtggtgccccagatgtggccacactgaccaggggcaagttc
tcttctgggatcacaggctgtatcaagaatctggtgttgcacacggcccggcctggagcc
ccacctccacagcccctggacctgcagcatcgcgcccaggcaggggccaacacacggccc
tgcccctcatag

DBGET integrated database retrieval system