KEGG   Mus musculus (mouse): 15551
Entry
15551             CDS       T01002                                 

Gene name
Htr1b, 5-HT-1B
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04726  Serotonergic synapse
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    15551 (Htr1b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15551 (Htr1b)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    15551 (Htr1b)
  09157 Sensory system
   04742 Taste transduction
    15551 (Htr1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    15551 (Htr1b)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    15551 (Htr1b)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 15551
NCBI-ProteinID: NP_034612
MGI: 96274
Ensembl: ENSMUSG00000049511
Vega: OTTMUSG00000044868
UniProt: P28334 Q0VES5
Position
9 E1; 9 44.61 cM
AA seq 386 aa
MEEQGIQCAPPPPAASQTGVPLTNLSHNCSADGYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCAG
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggaggagcagggtattcagtgcgccccgccgcctcccgccgcctcccagacaggggta
cctctcaccaacctctcccacaactgcagcgccgacggctacatttaccaggactccatc
gccctgccctggaaagtcctgctggttgctttgttggcgctcatcaccttggccaccacg
ctctccaacgcctttgtaatcgctacggtgtatcggacccggaagctacacaccccggct
aactacctgatcgcctctctggcagtcactgacctgctcgtgtccatcctggtgatgccc
atcagcaccatgtacacggtcactggacgctggacactaggccaggtggtctgcgacttc
tggctgtcgtcggatatcacctgttgcactgcttccatcatgcatctctgtgtcatcgcc
ctggaccgctactgggccatcaccgatgcggtggagtattctgctaaaaggactcccaaa
agggcggccatcatgatcgtgctggtgtgggtcttctccatctctatttcgttgccaccc
ttcttctggcgtcaagccaaagcagaggaggagatgctggactgctttgtgaacaccgac
cacgtcctctacacggtctactccacggtgggcgctttctatttacccaccctgctcctc
atcgccctctatggccgcatctatgtggaagcccgctctcggattttgaaacagacaccc
aacaagaccggcaagcgcttgacccgagcccagttgataacagactccccgggatccaca
tcctcggtcacctccattaactcccgggctccggacgtgcccagtgagtccgggtctcct
gtgtacgtgaaccaagtcaaagtgcgagtctcagacgccctgctggaaaagaagaaactc
atggccgctagggagcgcaaagccaccaagaccctagggatcattttaggagcatttatt
gtgtgttggctgcccttcttcatcatctccctggtgatgcctatctgtaaggatgcctgc
tggtttcacatggccatttttgacttcttcaattggttaggctatcttaactccctcatc
aaccccatcatctacaccatgtccaatgaggacttcaaacaagcgttccacaaactgata
cgctttaagtgcgcaggttga

DBGET integrated database retrieval system